KEGG   Zunongwangia profunda: ZPR_2884Help
Entry
ZPR_2884          CDS       T01216                                 

Definition
(GenBank) antibiotic biosynthesis monooxygenase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABM FERM_f0
Motif
Other DBs
NCBI-ProteinID: ADF53204
UniProt: D5BGM3
Position
3111017..3111724
Genome map
AA seq 235 aa AA seqDB search
MKKPLIKTLVCIGLLIGSHHFINAQEQESFQKLVKLPVREAAYDSYLALMRINIEQSRKE
DGNISFTLFGKDGDYTVYLLERFKNKAAWEEHKKSVYARSTDAISPAATMHLSEETILKE
IPEIPAADTEIVIPEENTKNIITWFTVQPTATTAFIEAMSKAIPKARETEENLGYNIYQN
AEDPNKFIVIERWRNPEVYQNYLQSEYSKKLNQDVEGLLTKEAKLKREVLKNISE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccacttatcaaaactttagtatgtatagggttacttattggttctcatcat
tttataaacgcacaggaacaggaaagttttcagaaactggtaaaattacctgtaagggaa
gctgcttacgatagttatttagctttaatgcgtattaatattgaacaatccagaaaagaa
gatggcaatatctcttttacattatttggtaaagatggtgattatacggtataccttctc
gaacgttttaaaaataaagcggcctgggaagagcataaaaaaagcgtatatgccaggtct
acagatgccatttcgcctgcagcaaccatgcatttatcagaagaaaccatacttaaggaa
attcctgaaattcctgctgcggatactgaaatcgttattcctgaggaaaacacgaaaaat
attataacctggtttacagtacaacctactgccacaaccgcatttattgaagccatgagc
aaagccatcccaaaagcacgagagacggaagaaaatttaggatacaatatttatcagaat
gctgaagatcccaataaatttatcgtaattgaacgatggagaaatcctgaagtttatcaa
aactatttacaaagtgagtatagtaaaaaactcaatcaagacgtagaaggcttacttacc
aaagaggctaaattaaaaagggaggttttaaaaaatatttcagaataa

DBGET integrated database retrieval system