KEGG   Zunongwangia profunda: ZPR_2894Help
Entry
ZPR_2894          CDS       T01216                                 

Definition
(GenBank) protein containing alpha/beta hydrolase fold
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Thioesterase Hydrolase_4 Abhydrolase_6 Abhydrolase_5 SAM_decarbox DUF4857
Motif
Other DBs
NCBI-ProteinID: ADF53214
UniProt: D5BGN3
Position
3118704..3119732
Genome map
AA seq 342 aa AA seqDB search
MKTTLRFILKIFKWIGKILAGFILLLLICGLCFRLFGSKPVPPGELVDINGTKLHIRAEG
QKNDLPSLILEAGAGSNTDMLHWIAEGLNKNMRVIRYDREGKWFSESSKDSITPEFYAKQ
LHRLLEKSGEKPPYILAGHSMGGPYNLIFQDLYPNEVKGMVFLDSSHPEQWKRLAQNELC
SDSQVIIVKTMAILTDMGIVGAFNTLFKSEPNNDGLPKELHTRSHNLTAYSGKVFHRYIK
ENNINNMILKRAGQTKSLDSLPILVFTATEQYEESQKEKYRNQGIDPDKQIELWFKMQKE
LKELSKNGKQFIINANHGSIITKKKNADMINKQILLMAETIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacactacgattcattcttaaaattttcaaatggattggtaaaattttggcc
ggttttattcttcttctattaatatgcggtttatgctttcgattatttggttcaaaacca
gtcccaccgggagagttagttgacattaatggaactaaactgcatataagagcggaaggc
caaaaaaatgatttaccaagtcttattcttgaagcaggtgcaggcagtaataccgatatg
ttgcattggattgcggaaggattaaataaaaatatgagagtcattcgttatgatcgagaa
ggaaaatggtttagtgaatcaagtaaagacagtattactccagaattttatgccaagcaa
ttgcatcgattacttgaaaaaagtggcgaaaaaccaccctatatattagcaggtcattct
atgggtggtccttataatctaatattccaagacctgtatcctaatgaagtaaagggaatg
gttttcttggattcgagtcaccctgaacaatggaagcgattggcgcagaacgagttgtgt
agtgatagtcaagtaatcattgtaaaaaccatggctatacttacggatatgggaattgtt
ggagcttttaatacattatttaaatcggaacctaataatgatggtttaccaaaggaactc
catacacgttcgcataatcttacggcgtattccgggaaagtattccataggtatatcaaa
gaaaataatattaataatatgattcttaagagagctggtcaaaccaaaagtttagattct
ttaccgatattggtttttactgcaactgaacaatatgaggaatctcaaaaggaaaaatat
agaaaccaaggcatagacccagataaacaaattgaattatggttcaaaatgcaaaaagaa
ttgaaagaactttccaaaaatgggaaacaatttattattaatgctaatcacggttccata
attaccaagaagaaaaatgcagacatgatcaataaacaaatactcctaatggctgaaaca
attaagtaa

DBGET integrated database retrieval system