KEGG   Zunongwangia profunda: ZPR_2895Help
Entry
ZPR_2895          CDS       T01216                                 

Definition
(GenBank) oxidoreductase, Gfo/Idh/MocA family protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA TAT_signal
Motif
Other DBs
NCBI-ProteinID: ADF53215
UniProt: D5BGN4
Position
complement(3120024..3121388)
Genome map
AA seq 454 aa AA seqDB search
MKSRRNFIKRSAVIGAGISLAPNLVFPFNPKPATDRLKIAFIGVGLRGTNHLNNAVHRKD
TEITAICDIDPKRIDIALELLKKDGRKKPMIFGKDENDYLNLLDAPDVDAVIIATPWLWH
TKMAVAAMKAGVYAGLEVSASQTIEECWDLVNTHEATGTHMMFLENVNFRRDVMAVLHMV
KQNVFGEMLHYRCGYQHDLREVKFNNGEQPYGGGVEFGEKGLSEARWRTKHSVLRNGDTY
PTHGVGPIAAMADINRGNRFTSMTANATKAVGLHKYVVDHGGEDHPNAKIKFKQGDVITS
MIECANGETIIVTHDTNLPRPYSLGFRVQGANGLWEKDGDRIYVEGQSEPHQWDNSAEWL
KKYDHPIWQKYGEEATGAGHGGMDYFVMKSFVESALANVAPPIDAYDAAAWSAITPLSEA
SIENNGEPQEFPDFTRGQWVARAPYDWMKDEYGK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaagaagaaattttatcaagagatcggcagtaataggggcagggattagcctt
gcaccaaacctggtatttccttttaatcctaaaccggcaacagatcgtttaaaaatagcg
tttataggtgttgggctaagaggaaccaatcatcttaacaatgcagttcaccgtaaggat
actgagattaccgcaatttgtgatatcgatcctaaacgtatcgatattgctctggaacta
cttaaaaaagacgggcgtaaaaaaccgatgatttttggtaaagacgagaatgattatctt
aaccttttggatgctcccgatgtagacgcagtcataattgcgacaccctggttatggcat
accaaaatggctgtagccgcaatgaaagcaggggtttatgccggacttgaagtttcggct
tctcaaactatagaagaatgttgggatttagtaaatacacacgaggctactggtacccat
atgatgtttttggagaatgtaaattttagaagagatgtgatggcagtactccatatggtt
aagcaaaatgtatttggtgaaatgcttcattatcgttgtggatatcaacacgatttaaga
gaagtaaaatttaataatggcgagcaaccctatggcggtggtgttgaatttggtgaaaaa
gggctttcagaagcacgttggagaacaaaacattctgttttacgaaatggagatacctat
cctacgcatggggttggccccatcgctgcaatggccgatattaacaggggaaaccgcttt
accagcatgaccgcaaatgctacaaaagccgtaggattgcataaatatgtggtggatcat
ggcggggaagatcatcccaatgctaaaatcaaatttaaacagggagatgtgataacctct
atgattgaatgtgccaatggggagacaataatagttacacacgataccaatctaccacgt
ccatattcattgggctttagagtgcagggagcaaacggactttgggaaaaagacggtgac
cgtatctatgtggaaggacaatcggaaccacaccagtgggataattctgccgaatggctt
aaaaagtatgatcatccaatatggcaaaagtatggagaagaagctaccggcgccggtcac
ggagggatggattattttgtgatgaaatcctttgttgagtcggcattagcaaatgtggct
cctcctatcgatgcttatgatgctgcggcctggagtgccataaccccgctatcagaggcg
tctatagagaataatggagaacctcaggaattcccggattttacgcgtggtcaatgggtc
gccagagcaccttacgactggatgaaagatgaatatggtaaataa

DBGET integrated database retrieval system