KEGG   Zunongwangia profunda: ZPR_2898Help
Entry
ZPR_2898          CDS       T01216                                 

Definition
(GenBank) putative outer membrane protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug CarbopepD_reg_2 CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ADF53218
UniProt: D5BGN7
Position
complement(3124437..3127364)
Genome map
AA seq 975 aa AA seqDB search
MIKLLSNLFFALFLVGAAFSQNEITGVVTDSDSGSPIPGVTVQVKGTSIGAVTDFDGNYN
IMGDVGEVLVFSYLGFSPKEVTISNDRIINVSLQPSTSELDEILVVGYTEQKKSSITSAV
SEVTSDELTDVTTSDVSTMLQGKAAGVQVVQGSGQPGSLPSLRIRGLTSINGGTNPLWVV
DGVIVHGTPNLNPNEVESISVLKDASATALYGSRGANGVVVVTTKQARLDQNTLRVSSRL
GYSYFNNGNFETMNSRQLYDYYQSFGNPNSIPEGVDEGVLTNDYDWFENGTQTGVIQDHN
LSFTGGNDKSKTFLSLGYYNETGTLKGYKYDRVSARLNHDYKVGDKLTLKPKVAVNYNKR
NNRQHSLYALYTYMPWDLPTDEEGEIINPQNLQNAQVWYGRDNANYLYNLQFDYSNSREF
NLFSNMDLEYQILPDLKFISTNSVTFYYADGMSYTDPKSTAGLANNGQLYKYSNKRITNF
TNQMLKYSKDFGAHRLNTLLAYEYQDYKYASNGATGYGIVSGTSILDNAATPGAVSGTTN
DSALQSVLFNADYGYDNRYLAQFSVRRDGASNFGKDNQYGTFYSGSLGWNIHNESFFNVE
TIDQLKLRASYGAVGNRPAALYPQYDLYSLQSTYNGLAAPSPYQYGNDDLAWEISYQTNI
GIDTRFYDRIALSLEYYNKDTSDLLYYVSLPSTSGYNGYYENIGGVENKGFEANLSVTIF
PHTQNGFGWTLTGNIGTNSNEVTELFEDADIDRGTKLSRVGEDYNTWFMRKWLGVDPDTG
SPLWEVVDPENGERSETTDYNAATKQIVGTSTPDFYGGFSSMMHYKGFSLSANFNFSKGG
YIYHSSRELYDADGAYPTYNQQVLQDGWSRWEEPGDMATHPQALYGGNNLSNKTSSRYLE
DASYLRMRNIRLGYSFPKVWLNNLKLGSFELYITGDNLLTLTDFSGTDPEVGIDGYASSQ
YPVSKRLAFGLNVSF
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacttttaagcaatttgtttttcgctttgtttctagtaggtgctgccttctcg
caaaacgaaataacgggtgtggtgaccgattcagattcaggatcaccaattcccggagtt
actgtccaagttaagggcacttctataggggcggtgaccgattttgatggaaattataac
ataatgggagatgttggtgaggtactggtgttcagttatctcggcttttctcccaaagaa
gttactatttctaatgatcgtattattaatgtaagtctgcagccatctacttcagaactt
gatgagatccttgtagtaggatataccgagcaaaagaaatcaagtataacttcggctgtt
tctgaagtgacatcagatgaacttacggatgtcactacttcagatgtttcaaccatgtta
cagggtaaagctgccggagttcaggtggttcaggggtcagggcaaccaggatccttgcct
tcattacgtattcggggacttacttctataaatggaggtactaatccattatgggtggtt
gatggcgtaattgttcacggcacgcccaacctaaacccaaatgaggtagaaagtatttcg
gtattaaaagatgcttcagcgacagcattgtatggttctcgaggagcaaatggggtagtg
gtggttactacaaaacaagccaggcttgatcaaaatacgcttagagtttcttcaaggcta
gggtatagttatttcaataatggcaattttgaaacgatgaattccaggcagttgtatgat
tactaccagtcttttggtaatcctaacagcattcccgaaggagtagacgagggcgtgcta
acgaatgactacgactggtttgaaaatgggacacaaaccggtgtgattcaggatcacaat
ctaagttttacgggaggaaatgacaaatcaaaaacatttttatcattaggatattataat
gaaaccggcacactaaagggctataaatatgatcgggtaagtgcacgtcttaatcatgac
tataaggtgggagataaacttaccttaaaaccaaaagtagcggtaaattacaataaacgc
aacaatagacaacattcgctatacgccttatatacctatatgccatgggatcttcctaca
gatgaggaaggcgagattatcaatccacagaatttgcaaaacgcacaggtttggtatggc
cgggataatgctaactatctgtacaatctacaatttgactatagtaatagtagagaattt
aacctgttttcaaatatggatttggaataccagatcctgcctgatctcaagttcatttca
acaaatagtgtgacattttactatgccgatggtatgagttatacagatccaaaatctacg
gccggtcttgctaataatggtcagttgtataaatatagtaacaaacgtattaccaacttc
accaatcaaatgctcaagtattcaaaggactttggggctcatcgacttaacacgcttctg
gcttatgaatatcaggattataaatacgcgtctaatggtgcaaccggttatggaatcgtc
tcgggtaccagtattcttgacaatgccgcaactccaggagcggtatccggaacaaccaat
gattcagctcttcaatcggtattatttaatgcagactacgggtatgacaatcgatactta
gcccaattttctgtacgtagagacggagcttcaaattttggtaaggataatcaatatgga
accttttattctggaagcctgggatggaatattcataatgaaagcttttttaatgtcgaa
actatcgatcaattaaaacttagagccagttatggtgcggtaggtaacaggcctgcagca
ttatatcctcaatacgatttatacagtctgcagagtacctataacggtcttgctgctcct
tcaccatatcaatatggtaatgatgacttagcctgggaaatatcttatcaaaccaatatt
ggtatagatacgcgattctatgaccggatagctttgtcgttggagtattataataaagat
acctcagatttactatactatgtgagtctgccatcaaccagcgggtataatggctattat
gaaaatattggaggggtggagaataaaggttttgaagccaatctttcagtaactattttt
ccccatactcaaaatggatttggttggacacttaccgggaatattggaacaaacagcaat
gaggtaaccgagttatttgaagatgcagatatagatcggggcactaagttatctagagta
ggagaggactataatacctggtttatgcgtaaatggctgggagtagatccagatacgggt
agcccactttgggaggtagtagacccagagaacggcgagcgcagcgaaactacagactat
aatgcagcaaccaaacagatcgtaggaacatctactcccgatttttatggcggttttagt
tcaatgatgcattataaaggtttttcccttagcgccaacttcaatttctcaaaaggaggc
tacatttatcactcgagtagggaattgtatgatgcagatggtgcctacccaacctataac
caacaagtgttacaagacggctggagcagatgggaagagcctggcgatatggctactcat
cctcaggcactttatggagggaataacctttctaacaaaacctcttcgagatatcttgag
gacgcaagttacttaagaatgcgaaacatccgtttgggatatagctttccaaaagtatgg
ttaaacaatctcaaactgggcagttttgagctgtatatcaccggagataatttgcttacc
cttacagatttttcaggtacagatcctgaagtagggatcgatggctatgctagttcccag
tatccagtttcaaaacgtttagcctttggactaaacgtgtcattttaa

DBGET integrated database retrieval system