KEGG   Zunongwangia profunda: ZPR_2899Help
Entry
ZPR_2899          CDS       T01216                                 

Definition
(GenBank) phosphotransferase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase
Motif
Other DBs
NCBI-ProteinID: ADF53219
UniProt: D5BGN8
Position
complement(3128023..3129138)
Genome map
AA seq 371 aa AA seqDB search
MGLNKKELIASVFNAFNHNCTIEEIQEFSSGHINDTYFIGTSGAHNFVLQRINDEVFHNV
PALVNNKVKISKHLASQFPKLTAKEKYRHVLTFLPTRKGAYFYQDAFDNYWNLTYYIKDS
ISYDTVTDKEIAYEGGKLFGKFISQTSDFDAGQLVEIIPGFHDVPKRLIQFEKARDKACT
ERLEKAVSQIECVHSLQTEMVILQQLKDEGKIPTRVTHNDTKISNALFDRNNKGLCVIDT
DTVMPGIVHNDFGDAIRTICNTAEEDEKDLSLVKFNVKYYEAYLKGFLEELQHSLSDLEI
EFLPLGAKTIIFIMGLRFLTDYLAGDVYYKTSYAEHNLDRAKNQFKLIESFEDQYPDILK
LSKSILKSKRL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaataaaaaggagttaatagcttcggtttttaatgcttttaaccacaactgt
accattgaagaaatacaggaattttctagtggtcatattaatgatacgtactttatcggt
acttctggagctcacaattttgtattgcagcgtattaatgatgaagtatttcataatgtt
ccggcactggtcaataacaaagtaaaaattagtaaacacctggctagtcaatttccaaaa
ctcactgccaaagaaaaatatagacatgtgcttacttttctgccaacacggaaaggggct
tatttttatcaggatgcttttgataattattggaatttaacatattacatcaaagacagt
atttcttacgataccgttaccgataaagaaattgcctacgagggaggaaagttattcggt
aaatttattagtcagaccagcgattttgatgccggccagctagtagaaattattcctggc
tttcacgatgttcctaaaagattaatacaatttgaaaaagcaagagataaggcttgtacg
gaacgcttagaaaaggcagtttcgcaaatcgaatgtgtgcattcattgcagacagaaatg
gtaattttacagcaattaaaagatgaaggtaaaatacctactagggtaacacataatgat
accaaaatttctaatgcccttttcgatagaaataataaaggtttgtgtgttattgatacc
gatacagtaatgcccggtatcgttcataatgattttggtgatgccattagaacgatctgt
aataccgcggaagaagatgagaaggatttgagcctggtcaaattcaatgtgaaatattat
gaggcctaccttaagggctttttagaggaattacagcactcattatcagatttagaaatc
gaatttttaccattaggggcaaaaacgataatctttatcatgggattacgatttttgact
gattatctggcaggtgatgtgtactacaaaacttcttatgctgagcacaatctcgatcgt
gcaaaaaaccagtttaaacttatcgaaagctttgaagatcaatacccagatatcctaaaa
cttagcaaatctatattgaaatcaaaacgattatag

DBGET integrated database retrieval system