KEGG   Zunongwangia profunda: ZPR_2902Help
Entry
ZPR_2902          CDS       T01216                                 

Definition
(GenBank) putative LacI-family transcriptional regulator
  KO
K02529  LacI family transcriptional regulator
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:zpr03000]
    ZPR_2902
Transcription factors [BR:zpr03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    ZPR_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 LacI HTH_23 HTH_38 SpoIIID HTH_3 HTH_Tnp_ISL3 HTH_17 HTH_26 HTH_7 HTH_29 DUF3853 HTH_28 HTH_5 Sigma70_r4_2 TetR_N Sigma70_r4 HTH_31
Motif
Other DBs
NCBI-ProteinID: ADF53222
UniProt: D5BGP1
Position
3130366..3131418
Genome map
AA seq 350 aa AA seqDB search
MLMKKNYTIKDIAELAGVSKGTVDRVIHKRGKVSSKALEQVNKVLDQIEYKPNPIAKSLK
NNKVYNIAILLPDADNDPYWLPCYDAIKQIENEFSHFGIKIKKGIFNPQSTESFTKSAEI
ILAEKPDAILMVPLFYKEAKDFAKNCVDANIKMATFNNYIKDQKIDLQIGQDLFQSGRVA
AKLFNMLLGTKASLAILHIDEAFQNASHMQEKELGFKTYYLQKELDYDISVYNLKKEAKI
PFKKTIDHFLKSITPVDGLFVTTSKAYLLANCMTESFSKPLIIGYDLVAENIDHLAHDKI
AFLIHQDPKKQVYLSLTKLIEYFLFGKPLQESLSLPIDIINSENYPQYLK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgttaatgaaaaaaaattacaccattaaagatattgcagagttagctggcgtatctaaa
ggcactgtagatcgtgtaattcataaacgcggaaaagtatcttctaaagcattagagcag
gttaataaagttcttgatcaaattgagtataaacctaaccctattgcgaaaagcctaaaa
aacaataaagtttataatattgctatattgttaccagatgcggataacgatccctattgg
ctcccctgctatgatgcgataaagcagatcgaaaatgaatttagtcattttggaattaaa
ataaaaaaaggaatatttaatccccaatcaactgaatcatttactaaatcggcagaaatt
atccttgcagaaaagccggatgctatattaatggtgcctttattctataaagaagcaaag
gatttcgctaaaaattgtgtggatgccaatattaagatggcaacatttaataattatata
aaagatcagaaaattgatctgcaaattggtcaggatttatttcaaagtggacgcgtagct
gctaagctttttaatatgctattaggtacaaaagcttctttagctattctacatattgat
gaagcttttcaaaatgcatcccacatgcaggaaaaagaacttggttttaaaacctattat
ttacaaaaagaattagattacgatattagcgtatataatttaaaaaaagaggctaaaatt
ccttttaaaaaaaccattgatcattttctaaaatctataactcccgttgatgggttgttt
gtcactacatcaaaggcttaccttttagctaattgtatgacggaaagcttttctaaaccg
ttaatcataggttatgatcttgtagcagaaaatatcgatcatttagcacatgataaaatt
gcatttttaattcaccaggaccccaagaaacaggtatacctaagcttaactaagctcatt
gaatattttttatttggcaaacccctgcaggaatccttaagtcttcctatcgatatcata
aatagtgaaaattacccacagtacttaaagtaa

DBGET integrated database retrieval system