KEGG   Zunongwangia profunda: ZPR_2905Help
Entry
ZPR_2905          CDS       T01216                                 

Definition
(GenBank) two-component system sensor histidine kinase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA Flu_NS2 SWI-SNF_Ssr4
Motif
Other DBs
NCBI-ProteinID: ADF53225
UniProt: D5BGP4
Position
3133368..3134258
Genome map
AA seq 296 aa AA seqDB search
MSPIQNNASQLYRITYEAYSKFANGINRCSNFQEIGKVAEKHLKYIFNFHVIKLIIEKDN
KFMEYSLCGNNIWFGQKSLADLNNEELNLFKTGIPIRTAHIPENIAQGKLDISKLKNPYL
WSWLFNKDDHKMIVSLVADEERVFNSRDIEILKLAADCFDAKFKELNLKREIAKKNRILQ
GALTTIQNKNEEIYKINRNQKETIKKRTEEIVKKNEKLLKISVLNAHNIKEPLSRIQGII
ELFDLMDDESCRQELLPRLKSSVNEMDEIVREVIDMASRELIELKVKIDDPNHFSR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaattcaaaataacgcatctcaattatatagaataacttacgaagcttattct
aaatttgcgaatggtattaatagatgtagtaattttcaggaaattggaaaagttgcagaa
aagcatttaaaatatatttttaatttccatgtcatcaaactaattatcgaaaaggataat
aagtttatggagtattctttatgcggcaataatatttggtttgggcagaaaagtctggca
gacttaaacaatgaggaactcaatttatttaaaactggtattcctataagaacagctcac
atcccagaaaatatagctcagggaaaattggatatttctaaacttaaaaatccctattta
tggtcgtggttatttaataaggacgaccataaaatgatagtatccctggtggcagatgaa
gaaagagtttttaacagtagggatatagaaattttaaaacttgccgcagactgttttgat
gctaaatttaaagagttaaacctaaaacgggaaatagcgaaaaaaaacaggattttacaa
ggagcgcttacgacgattcagaataaaaatgaggaaatttataaaattaatagaaatcaa
aaagagaccattaaaaagagaacagaagaaattgtaaagaaaaatgaaaaacttttaaaa
atttcagttcttaacgcccataacataaaagagcccttatcccgtatccaggggattatt
gaattgtttgaccttatggatgatgaaagttgccggcaagagctattaccacgattaaaa
tcatcggtcaatgaaatggatgaaattgtaagagaagttatcgatatggcttcccgggaa
ttaattgaactaaaagttaaaatagatgaccccaatcattttagtagatga

DBGET integrated database retrieval system