KEGG   Zunongwangia profunda: ZPR_2909Help
Entry
ZPR_2909          CDS       T01216                                 

Definition
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
zpr  Zunongwangia profunda
Pathway
zpr02024  Quorum sensing
zpr03060  Protein export
zpr03070  Bacterial secretion system
Module
zpr_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ZPR_2909
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ZPR_2909
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ZPR_2909
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zpr03029]
    ZPR_2909
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:zpr02044]
    ZPR_2909
Mitochondrial biogenesis [BR:zpr03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    ZPR_2909
Secretion system [BR:zpr02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   ZPR_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 60KD_IMP YidC_periplas
Motif
Other DBs
NCBI-ProteinID: ADF53229
UniProt: D5BGP8
Position
3136781..3138646
Genome map
AA seq 621 aa AA seqDB search
MEEKKIDIQSIIGFILIGGILIWMLYTNSLEQPKEETGTPATTEQVTTPANADQQLANQN
NTTAPATDSAAIAQAQSRLGAFGYSATLPSAEDKTTVLENDVLRLEVANKGGYIEEAVLK
NYKTYDSIPVYLVKDGNAKFNLNFTTTDGRTLDTENLYFEPSISKNGEDQVLSMKLKISD
NEFLEYRYAIKPGDYMMDFNIRSQGLANTFNASQPINLDWQLKGYRHSKSISYENKYTVL
GYEYEGDKYDDLGHGEDEETEKDVSYIAYKQHFFSSILLTDTPFKTSKLTSQNLVEDEEI
DTVYTKAFTANIPLELQAGELNYNMNWYYGPTDYKILKDYDRNLDEIVPLGWGIFGWINK
YVFIPFFAFLSSVLPSYGIAIIVMTIVVRIVLSPVTYKSYLSQAKMKVLRPEINEINEKY
KDNAMKKQQETMKLYSKAGASPMSGCLPALMQIPIFYALFQFFPSAFQLRQKSFLWADDL
SSYDVIAELPFHIPFYGEHVSLFPILASVAIFIYMQMTTGQSMQANQQPGMPNMKFLMYL
SPIMMLFFFNNYASGLSLYYFTSNLITIGIMLVIKHVIVDEDKIHAKIQANKAKPKKQNR
FTRKMQEMMEQAEEQQKRNKK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagaagattgatattcaatccatcattggatttattttaattggcggaatt
ttaatctggatgttgtataccaatagcctggaacaaccaaaggaagaaaccggtactccc
gccacgacagaacaggttactactcctgcaaatgctgatcaacaactcgcaaatcaaaat
aatactactgctcccgcaaccgactcggcagcaatagcccaggcgcaaagtagacttggt
gcttttggttattccgcgacattaccttcggcagaagataaaaccacagtactagaaaac
gatgtgttacgattagaagtagcaaataaaggaggatatatcgaagaagctgttttaaaa
aattataaaacatacgattctatccctgtttatttagtaaaagatggcaacgcaaaattc
aatcttaatttcacgactacagatggaagaaccttagatactgaaaatctatattttgag
ccaagtatttctaaaaatggtgaagatcaggtattatcgatgaagttaaagatttctgat
aatgaattcttagaatatcgttatgctataaaacctggagattatatgatggatttcaat
atccgttcccagggacttgccaatacctttaacgcatcccaacctattaatctggattgg
caacttaaaggataccgtcattccaagagtatttcttatgaaaataaatacaccgtttta
gggtacgaatacgaaggagataagtatgatgaccttggacatggggaagatgaagaaaca
gaaaaagacgtgtcttatattgcctataagcaacatttctttagttccatacttttaaca
gatacaccgtttaaaacctccaaacttacttcccaaaatcttgtggaagacgaagaaata
gatactgtatacaccaaagcttttaccgcaaatattcctttagagttacaggcgggcgag
ctaaattataatatgaattggtattacggccctacagattacaaaatcctgaaagattac
gatcgcaatctggatgagattgtacctctaggctggggtatattcggatggatcaataaa
tatgtctttatcccattctttgcattcttaagcagtgtcctaccaagctacgggatcgcc
atcattgtaatgaccattgtggttaggattgtgctttcaccggtaacttataagtcttat
ttatctcaggccaaaatgaaagttttacgtcctgaaattaatgagataaatgagaagtat
aaggataatgcgatgaaaaagcaacaggaaacaatgaagctttatagcaaagccggagct
agccccatgagtggttgtttaccagcgctaatgcaaattcctatattctatgcgcttttc
caattcttcccaagcgcatttcaactaagacaaaaaagtttcctttgggcagacgatcta
tccagttatgatgttatagcagaattacctttccatatcccattttatggagaacatgtt
agtttattcccaatattggcttctgtcgcaatatttatttacatgcaaatgactacggga
caaagcatgcaggccaatcaacaaccgggaatgcctaacatgaaatttttaatgtaccta
tcccctatcatgatgttatttttctttaataactatgccagtggattatctttatactac
tttacctctaacttaattacgataggaataatgttggtaattaaacatgtgattgttgat
gaggataaaatccatgctaaaattcaggctaataaagcaaaacctaaaaaacaaaacagg
tttaccagaaaaatgcaggaaatgatggagcaggctgaagagcaacaaaaacgtaacaag
aaataa

DBGET integrated database retrieval system