KEGG   Zunongwangia profunda: ZPR_2914Help
Entry
ZPR_2914          CDS       T01216                                 

Definition
(GenBank) LysM domain-containing protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM Peripla_BP_6 ANF_receptor DUF3855 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ADF53234
UniProt: D5BGQ3
Position
3142050..3144041
Genome map
AA seq 663 aa AA seqDB search
MMNISAFAQEFKYHTVKKGETVYSISKDYNVSEEDIYKYNPDSKNGIEESSKLVIPLATK
DKGMPAKTGSSSLDPVNFKEHTVKKKETLFSLSQQYNVEIDDIKRYNKQLYSKELQKGET
IRIPVFRTLDRVVAKPNNISKEEIRQKFDKNEVREHVVLPKETKFGIARKYGLTVKELEA
LNPTVDVLQPGIMLRVGTNVSPDPVVLLDKNFKFYEVKPQETLFGLAQRFHVTQDSILAL
NPIIEQEGLEWGMVLKVPNPEEQDPENWVTPTLTSEAEKLQGDKVNLKDSLSNFSPKNLV
FMLPYSLDKVQVDSAGTAAYKDAILDDRVLRISLDFYSGAAMAIEDAKELGISSQVKIYD
TKRSASEVINLINTKNFNNVDAVIGPFLQSTTEAAAERLRIKNIPVFTPLSDKEMSGGNN
LFIARPDQQTMSNTMLDYLQKFGKEKNVIIVSDAKSFEIKNKLSQIFPAARSVNAVDGYV
SETSLKRVLLPATPNWIILESSSVGVISSTVSALNRLLRDDLDITLFTTNKNDSYDNESI
SNEDLGKLYFHYPSVDKEYNLEFSENFIKKYQEEYGVTPNQYAVRGYDLTMDVLLRLAAS
KDIYSSFSDYKGFTEYNENKFLYEPQPGGGFRNKAVYILQINPDLTLQIADDSQSNIFRE
FKD
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatatttctgcttttgcgcaggaatttaaatatcataccgtaaagaaaggagag
actgtttacagtatttctaaggattataatgtttctgaagaagacatttataaatataat
cctgactctaaaaatggtatcgaagaatcttctaagctggttatccctttagccacgaag
gataaagggatgcctgctaaaacaggctcttcaagtttggatcccgtaaattttaaagaa
cataccgttaaaaagaaagaaactctctttagtttatctcagcaatataatgtagaaata
gatgatattaaacggtataataaacaattatactctaaagaacttcaaaaaggagaaact
attcgtattcctgttttcagaactttagatcgggtggttgccaagcctaacaatatctct
aaagaagagattcgccagaaatttgataaaaatgaagtgagagagcatgttgttttaccc
aaagaaaccaaatttggtatagccagaaaatatggtttaacggtaaaagaactggaagcc
ttaaatcccactgtagatgttttgcagcccggtattatgcttagggttggtacaaatgtc
tccccagatcccgtggtacttttagataagaactttaagttttacgaagtaaaacctcaa
gaaactttatttggtttagctcagcgttttcatgtaacacaagattctatattagcactt
aacccaattatagaacaagaaggattagaatggggcatggttttaaaagttccaaatcca
gaagaacaagaccccgaaaactgggtgacccccaccctaaccagtgaagctgaaaaattg
caaggtgataaagtaaaccttaaagattctctttccaatttcagtcctaaaaacctggta
tttatgcttccttatagccttgataaggttcaggtagattcggcaggtactgctgcttat
aaagacgccattttagacgatcgtgttttaagaataagcctggatttttacagcggtgct
gcaatggccattgaagatgcaaaagaattagggatttctagtcaggttaaaatttatgat
accaaaagaagtgcttctgaggtgattaatcttatcaataccaaaaattttaataatgtt
gatgcagtcattgggccttttttacaatcgactacagaagccgctgcagaacgcttaaga
atcaaaaatattccggtattcacaccactttctgataaagaaatgagcggaggtaataat
ttgttcatcgcgcgtcccgatcaacaaacgatgagcaatactatgctcgattaccttcag
aaatttggaaaagagaaaaatgtgatcattgtctcagatgctaaatcttttgaaattaaa
aataaattatctcagatttttcctgcagcaagatctgtaaatgctgttgatggttatgtt
tcagaaacaagcttaaaaagagtattattgccagccacaccaaactggataattttagaa
tccagcagtgtgggtgtgataagtagtaccgtatctgcattaaataggttattaagggac
gatcttgatattacattattcactacaaataaaaatgatagctacgataacgaaagcatc
agtaacgaagatttaggcaaattatatttccactacccatcggtagataaagagtataat
ctagagttttctgagaattttattaaaaagtaccaagaagagtatggtgttactccaaat
caatatgccgtgcggggctatgacctaaccatggatgtattactccgtttagctgcatca
aaagatatttacagttcttttagcgattataaaggctttaccgaatacaacgagaacaaa
tttttatatgagccgcaacccggaggtggtttcagaaataaagcagtttatattcttcaa
attaatccggatttaactttacaaatagccgatgacagccaaagtaacatatttagggaa
tttaaggactga

DBGET integrated database retrieval system