KEGG   Zunongwangia profunda: ZPR_2918Help
Entry
ZPR_2918          CDS       T01216                                 

Definition
(GenBank) hypothetical protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7tm_3 DUF3671 DUF2207 DUF131 ABC2_membrane_3 MARVEL BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADF53238
UniProt: D5BGQ7
Position
3145304..3145567
Genome map
AA seq 87 aa AA seqDB search
MEVYHQNEQPNLITPQKWALYIFVAGLPFIGIIMLLVWAFGSDPNYTRKNWAKGMLLLYV
ILFILSIIFFVFLGGMAFLTSFASQNY
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatcatcaaaacgaacaacctaacctaattacaccacaaaaatgggcctta
tacatttttgttgccggcttaccttttataggcatcatcatgctactggtatgggctttt
ggcagtgatcccaattatacacgcaaaaattgggcaaaaggtatgctattgctatatgta
atactattcatattatctattattttctttgtattcctgggaggaatggcattcttaaca
agctttgcgtctcagaattactaa

DBGET integrated database retrieval system