KEGG   Zunongwangia profunda: ZPR_2920Help
Entry
ZPR_2920          CDS       T01216                                 

Definition
(GenBank) 2-nitropropane dioxygenase family protein
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00061  Fatty acid biosynthesis
zpr01100  Metabolic pathways
zpr01212  Fatty acid metabolism
Module
zpr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ZPR_2920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zpr01004]
    ZPR_2920
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ZPR_2920
Lipid biosynthesis proteins [BR:zpr01004]
 Fatty acid synthase
  Component type
   ZPR_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH FMN_dh ThiG DHO_dh Glu_synthase His_biosynth NanE Dus
Motif
Other DBs
NCBI-ProteinID: ADF53240
UniProt: D5BGQ9
Position
complement(3148720..3149664)
Genome map
AA seq 314 aa AA seqDB search
MATNRITKLLNIKYPLIQAGMVWASGWKLASAVSNAGGLGIIGAGSMYPEVLKEHLIKCK
KATNKPFAVNVPMLYPNVEEIIKIIVAEKVPIVFTSAGNPTTWTSHLQEHGIIVVHVVSS
VKFALKSQEAGVDAVVAEGFEAGGHNGRDETTTFTLIPMVREKLEIPLIAAGGIATGRGM
LAAMVLGADAVQIGSRFVASEEASSHIKFKEMVVNAQEGDTKLTLKELAPVRLLKNKFFE
DIETLYQKSPSKEELQQLLGRARAKKGMFEGDLIEGELEIGQISGLIKTIKPAAEIVKEI
VDEFESVQSQLHQY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaatagaataaccaaacttttaaatataaaatatccacttatccaggccggt
atggtctgggcaagtggctggaaactggcaagcgctgttagcaatgctggtggacttgga
atcattggcgccggatctatgtatcctgaagtgcttaaagaacatcttataaaatgtaaa
aaagcgaccaacaagccttttgctgtaaatgttcctatgctctatcccaatgtggaagag
attataaaaattattgttgcagagaaagttccaatcgtttttacatcagctgggaatcca
acaacctggacttctcatttgcaagaacatgggattattgttgttcatgtagtaagtagt
gtaaaatttgctttaaaatctcaggaggctggagtagacgctgtggttgccgagggattt
gaagctggtgggcataatgggcgtgatgaaaccacgacctttaccttaattcctatggtt
agggaaaagttggaaattccacttatcgcagccggtggaattgctaccgggcgtggtatg
cttgcagcgatggttttaggagccgatgccgtacaaattggcagccgctttgtcgcttct
gaagaagcctcttctcacattaaatttaaggaaatggtggtgaacgctcaggaaggtgat
actaaattaacactaaaagaattggctcccgttcgtttacttaaaaataaattcttcgaa
gatattgaaacactttatcaaaaaagtccttctaaagaagaattacaacagctcttgggt
cgcgcccgtgccaaaaaaggcatgtttgaaggtgatctgatagaaggagaactcgaaatt
ggtcaaatttcaggcttaattaaaacgatcaaacccgccgcagagattgtaaaagaaatc
gttgacgagttcgaaagtgtacaatctcaattacatcaatattaa

DBGET integrated database retrieval system