KEGG   Zunongwangia profunda: ZPR_2921Help
Entry
ZPR_2921          CDS       T01216                                 

Definition
(GenBank) tRNA methyl transferase
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
zpr  Zunongwangia profunda
Pathway
zpr04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    ZPR_2921
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zpr03016]
    ZPR_2921
Enzymes [BR:zpr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     ZPR_2921
Transfer RNA biogenesis [BR:zpr03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    ZPR_2921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans NAD_synthase Asn_synthase ThiI QueC
Motif
Other DBs
NCBI-ProteinID: ADF53241
UniProt: D5BGR0
Position
complement(3149686..3150873)
Genome map
AA seq 395 aa AA seqDB search
MKKVVVGLSGGVDSSVSAYLLKEQGYEVIGLFMKNWHDDSVTISDECPWLEDSNDAMIVA
EKLGIPFQTVDLSEQYKERIVDYMFNEYERGRTPNPDVLCNREIKFDVFMKIALSLGADY
VATGHYCRKGEIEKNGEKIYQLLSGKDNNKDQSYFLCQLTQEQLSKTLFPIGELQKSEVR
RIAAEQELVTADKKDSQGLCFIGKVRLPDFLQQKLKPKEGNIVEIKPDSETYQTGIPEFE
SKIEELKFLSQKYQYQPQDGKVVGKHQGAHYFTKGQRKGLAVGGTPEPLFVIDTDVEDNV
IYTGQGKKHPGIYRKGLFINEDEVHWVRKDLSLKPGESLELKARIRYRQPLQEATLYQTE
QGMYVVFKTPQASITEGQFVAWYDGEELLGSGVIS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttgtagtaggactctcaggaggtgtagatagtagtgtttcagcctatctt
ttaaaagaacagggttatgaggttataggattgtttatgaaaaactggcatgacgattcg
gtgacgatttcagacgaatgtccatggttagaagacagtaatgatgcgatgatcgttgct
gagaaattaggaatcccattccaaacggtagacttaagcgaacaatataaagaacgtatc
gtcgactatatgtttaatgaatacgaacgtggtcgaacaccaaatccagacgtgttatgt
aatcgtgagatcaagtttgatgtatttatgaaaatagcactttctctgggagcagactat
gtggccaccggtcattactgccgtaaaggagaaattgaaaaaaacggagaaaaaatatat
cagctattatcaggaaaagataataacaaagatcagtcttattttttatgtcagcttacc
caggagcaactttcaaaaaccttatttcctattggggaacttcaaaaatcagaggttcgt
aggattgctgccgaacaggaactggtaactgccgataaaaaagattcgcagggactttgt
tttataggaaaagtacgcttgccagattttcttcagcaaaaattaaagccgaaagaaggg
aatattgtcgagataaaaccggatagcgaaacctaccaaactggtattcccgaatttgaa
tctaaaattgaagaattaaaatttctatctcaaaaataccaatatcagcctcaggatggt
aaagttgtaggaaagcatcagggtgctcattattttactaagggacaacgtaaaggttta
gctgtaggaggtactccagaaccactttttgtaatcgatacagatgttgaagacaatgtt
atttataccgggcagggaaaaaaacatcccggaatttatcgaaaaggactttttattaat
gaagatgaagtacactgggtaagaaaagacttaagtttaaaaccgggcgaaagcttagag
ctaaaggcaaggataagataccggcaacctttacaggaggcaactttatatcaaaccgaa
caaggtatgtatgtagtttttaaaacaccacaggcttctattaccgaaggccagtttgtg
gcctggtatgatggcgaagaattattaggatctggtgtaatttcttaa

DBGET integrated database retrieval system