KEGG   Zunongwangia profunda: ZPR_2924Help
Entry
ZPR_2924          CDS       T01216                                 

Definition
(GenBank) protein containing fasciclin domain
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fasciclin DndE Phage-tail_1 Baculo_E25
Motif
Other DBs
NCBI-ProteinID: ADF53244
UniProt: D5BGR3
Position
3151936..3152910
Genome map
AA seq 324 aa AA seqDB search
MKFILKLAKIILIFIFCSIIISCGTSDDPGDVIIPDNTINNFILNNSNYSVLATALNRTS
LDSVLNSTMQQYTIFAPNNSAFNSFLSENDYTNINDVPLKELENYLRYHIQPGASKLSEF
PDGYIRSLGTGNVSDRLLSMYTSTLDDSFYINNEAEVVVSQGNILLDNGYLNPISTFLSL
PSITDFLLVSQQSSDDSFASILSESTSENYLARLEDEDAVFTILQASEEAIANYLSENNY
AAINDIPQANLQKIIDNHIIPQENVRTEAIEDSLQVTANSGALLNFYEDNGPKIKLENNE
IINIITPNIQAVNGVIQIVDRVIE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattctgaaattagcaaagatcatactaatttttattttttgcagcataata
atctcctgcggtacatcagatgatcccggcgatgtcattattcctgataatacgataaac
aattttattcttaataattctaattattcggttttagccactgctttaaatcgcacgagc
ctggattcagttttaaatagtacgatgcaacagtacacaattttcgccccaaataattcg
gcattcaatagtttcctttctgaaaatgattataccaatatcaatgacgttcctctaaag
gaattagaaaattatcttcgttatcatatacagccgggagcgagtaagttaagtgaattt
ccagatgggtatatacgaagtctggggactgggaatgtttcagatagattgcttagcatg
tatacttcaactttagatgatagcttttatatcaataatgaagctgaagtagtcgtatct
cagggtaatattttactggataatggatatctgaaccctatcagtacttttttgtcctta
cccagtataactgattttttattggttagccagcaaagttcagatgatagttttgccagt
attttatctgaatccacttctgaaaattatttggcccgattggaagatgaagatgcggtg
ttcactattcttcaggcctcagaagaagctatcgcaaattacctatcagaaaacaattat
gctgctattaacgatattccacaggctaacctgcaaaaaattattgataatcatatcatt
ccgcaagaaaatgtacggaccgaagctattgaagattcactacaggttactgcaaatagt
ggtgcactactgaacttttacgaagataacggtccaaaaatcaaattggaaaataatgag
atcataaatattattacgccaaatattcaggctgtaaatggagtaattcagatcgttgat
cgtgtaattgaataa

DBGET integrated database retrieval system