KEGG   Zunongwangia profunda: ZPR_2926Help
Entry
ZPR_2926          CDS       T01216                                 

Definition
(GenBank) CmpR
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like
Motif
Other DBs
NCBI-ProteinID: ADF53246
UniProt: D5BGR5
Position
3153465..3154388
Genome map
AA seq 307 aa AA seqDB search
MNYTLNQLKIFLKITELKSITKASESLHLTQPAVSIQLKNFQDQFDIPLTEVIGRQLYVT
PYGEEIAKAAEKILLEVENMKYKSLAFKGKLAGQLTIAVVSTGKYVMPFYLAPFLSKHNG
VNLFMDVTNRYQVLEALERNEVDFALVSVLPENLQVEKRTFIDNKLFLFGSPSLIKSVPI
KGQIIPENLPLIYREEGSATRQAMEKFISQNKIPVTKKIQLTSNEAVKQAVLAGLGYSIM
PIIGLENEIKNNQIQIVPIQKLPIVTSWNLIWLKGKKFSPAAVAYLDFLTKHIESINEAN
FSWLSSY
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaactatactttaaatcaactaaagatatttttaaaaataacggagttaaaaagtatt
acaaaagcttcagaatcgctgcatcttacgcagcccgcagtttccattcagctaaaaaat
tttcaggatcagtttgacatcccactaaccgaagttattggcagacaattatacgttacc
ccttatggtgaagaaattgccaaagccgctgaaaaaattttattggaggttgaaaatatg
aagtataaatctttggcttttaaaggtaaactggctggacaacttactatagccgtagtt
tctacaggcaaatatgtgatgcctttttatttagctccctttttaagcaaacataatggt
gtcaacctgtttatggatgtaaccaaccgttatcaggtattggaagctttagaaagaaat
gaagtagattttgctttggtttctgtactaccggaaaatttacaggtcgaaaaaagaacc
tttatagacaataaacttttcttgtttggtagtccttctttaataaaatcggtaccgatt
aaaggccaaataattcctgaaaacttacctctgatttatagggaagaaggttctgctacc
cgacaggctatggaaaaatttataagtcagaataaaattccagtaaccaaaaaaattcag
cttacttcgaacgaagcggtaaaacaagcggtattggcgggactgggctatagcattatg
cctataattggtttagaaaatgaaataaagaacaaccagatacaaattgtacctatccaa
aaattacccattgtaacctcatggaatttaatctggttaaaaggcaaaaaattttcacct
gcggctgtcgcatatttagattttcttaccaaacatattgaaagtattaatgaagcaaat
ttttcctggttatctagttattaa

DBGET integrated database retrieval system