KEGG   Zunongwangia profunda: ZPR_2927Help
Entry
ZPR_2927          CDS       T01216                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09822  uncharacterized protein
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ZPR_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2309
Motif
Other DBs
NCBI-ProteinID: ADF53247
UniProt: D5BGR6
Position
complement(3154530..3156860)
Genome map
AA seq 776 aa AA seqDB search
MKTTEWKKSLEEISKIVDKTSPLYAYITSNQLSGFEEYHFKEAVSRASTFYNAHGYPNAE
VFREALDSRELYSAELENLLIENGYQDSIEAYLKILGQVSAIKEQPDNLKLNRLMLKWLS
IFMDEGVAEWPMPNREKGFYKAWLGLAKYDKDYQIYKDTPQTATAALDQLFQNFSKEEVQ
NSIEFHLTSLPGWVGYIKQRQTSDSGWRKKAPITILEYLAVRLTIAEKLNLLIDVAPAFE
TANEQQELSYLFLKAWEISWQKELTEKYIHNRVPETNNNIPDAQMVFCIDTRSELIRRKI
EETDNYETFGYAGFFGIAMDYKSTEDGLTRKSCPPILNSAYKVSYDVKPGKETQAKAYKK
QLKKIKFKNYFFKRLKNMLPSAFGYVEGTGILYGLSLLGRTLLPAKYHKLMNGDKIASEK
SYEPKLAKKEHKHDISLEEKVSLVKATFDLTGWKIFAPVIIFTGHGSHTSNNPFASSLDC
GACAGNPGRHNARTLASIANEKEVRLALKNNFGIDIPENTIFLGAEHNTVTDEIEIFDTE
FAPNHKEALLKITENLKQAQLEASRERLGSEKESLKLAHKKSHNWSETRPEWGLAKNASF
IIGPRGLTKGLNLNGRCFLQSYDWKTDKDGTALSAIMQGPMVVTQWINNHYYFSTVDNEK
FGAGSKITHNITGKFGVMQGNGSDLTKGLPLQSLKRSDSEMYHQPLRLSVVIETPTNRVE
KILEEQPHLKNLLDNEWIYLLVINPEENREIKRYAPGLNWENLDNNSTTDDVKLAV
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaactgaatggaaaaaatccctggaagaaatctctaaaatcgtagataaaact
tcgccattatatgcttatataacctccaatcaactttcaggttttgaggaatatcatttt
aaggaagccgtaagcagagcttccacattttataatgcgcatggatatcctaatgccgaa
gtattcagggaagcactggatagcagagaactttatagtgctgaattagagaatttatta
atagaaaatggctatcaggattctatagaagcttatctaaagattcttggtcaggtttca
gcaataaaagaacagccggataacttaaaactaaatagattaatgctcaagtggctttct
atttttatggatgaaggcgtggcagaatggcctatgcccaacagggaaaagggtttttat
aaagcctggttaggtttagccaaatacgacaaggactatcaaatatataaagatacgcca
caaacagctactgcagctttagaccaattatttcagaatttttctaaagaagaggtacaa
aatagcattgagtttcatttaaccagtctgccgggatgggtggggtatatcaaacaacgc
caaacttcagactcgggatggagaaaaaaagcgcccattactattttggagtacttggcg
gttaggcttacgattgcagaaaaattaaacttacttatagatgtagcacctgcttttgaa
actgccaatgaacaacaggaactgtcttatttgtttctaaaagcctgggaaataagctgg
caaaaagagcttactgaaaaatatatccataatcgagtgcctgaaacaaacaataacata
ccagatgcacaaatggtgttttgtatcgatacacggtctgaactgataagaagaaaaatt
gaagaaacagacaattatgaaacatttggatatgcaggtttctttggcatcgcaatggat
tataaaagcactgaagatggtttaacaagaaaatcctgccctccaattctgaattctgct
tacaaggtttcttatgatgtaaaaccaggaaaagagactcaggcaaaagcttataaaaag
caactcaaaaaaatcaagtttaaaaactatttctttaaaagattgaaaaatatgctgcct
tctgcctttgggtatgtagaggggacaggaattctttatggtttgtctttgcttggtaga
accttgctacctgccaaataccataaactaatgaacggtgataagatagcttcagaaaaa
agctacgagcctaaactggcaaaaaaggagcataaacacgatatttctttagaagaaaaa
gtaagccttgtaaaagccacttttgatttaaccggttggaaaatctttgctcccgttatc
atttttaccggtcacggtagtcacacttctaataatccatttgcttccagtttagattgc
ggtgcctgtgcaggaaaccctggaaggcacaatgcacggactttagcctctattgctaat
gaaaaagaagtaaggttagcattaaaaaataattttggaatcgatataccggaaaacaca
atatttctgggagccgagcataatacggttaccgatgaaatagagatttttgataccgaa
tttgctccaaatcataaagaagcacttttgaaaataactgaaaatctgaagcaggcacaa
ttagaagcgagccgcgaacgactgggaagcgaaaaagagagtttaaagttagctcacaaa
aaatcacataactggtcggaaaccagacctgaatggggcttggccaaaaatgctagtttt
atcattggcccaaggggacttaccaaagggctcaatttaaacgggagatgttttctgcaa
tcttacgattggaaaaccgataaagacggaactgctttatctgcaatcatgcaaggacct
atggtggttacccaatggattaataatcactattactttagcacagtagacaatgaaaaa
tttggtgcaggctctaaaattacccataatataaccggcaagtttggggtgatgcagggg
aatggaagtgatttaaccaaaggtttacccttgcaatctttaaagcgtagtgattcagag
atgtatcatcagcctttacgattatcggtcgtaattgaaacacctacgaatagggtagaa
aagattttagaagaacaacctcacttaaaaaacttactggataacgaatggatttactta
ctggtaatcaatcctgaagaaaaccgtgaaataaagcgttatgctcctggtttaaactgg
gaaaacctggataacaattcgacaactgacgatgtaaaacttgctgtttaa

DBGET integrated database retrieval system