KEGG   Zunongwangia profunda: ZPR_2931Help
Entry
ZPR_2931          CDS       T01216                                 

Definition
(GenBank) zinc carboxypeptidase
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M14 ABC_transp_aux Glyco_hydro_42M BPL_N ALS_ss_C GATase1_like DUF1825
Motif
Other DBs
NCBI-ProteinID: ADF53251
UniProt: D5BGS0
Position
3162248..3164719
Genome map
AA seq 823 aa AA seqDB search
MKNKLLLITFTILSFVNVKAQVKSPSDFLGYELGSQFSRHADVVDYFKYIAEKSPLVTYH
TYGKTNERRPLTCAVISTKENLGNIEEIRKNHLRQTGILDGTPTTDKAIVWLSYNVHGNE
ASSTEASMKTLYNLITEKQDWLKNTIVIIDPCVNPDGRDRYANWYNQVKQTPFSTSQDAA
EHYEPWPGGRPNHYLYDLNRDWVWATQVETQSRLKIYNQWMPHIHVDFHEQGINNPYYFA
PAAEPFHDIITPFQRDFQTRIGKNNAKYFDKEGWLFFTKESFDLLYPSYGDTYPTYMGAI
GMTYEQAGHGRGGLGIKTDQGYILTLKDRIEHHFTTGISTIEMASKNAEELSQEFSNYFS
DLDRKYQTFALNGDKDKIDALKELLDRHEIKYSNARSGEKISGYSFTENKDGNLITTHQT
LLVSTQQPKGHMVEVLFEPKTKLNDSITYDITAWSLAYAYGLNAVASTKAYSGKSTTETS
NINNTVNAEGAGYIAKWNSMKDAEFLAALLKQNVKVRFSELPFSSEGKKFSAGSLIITKS
DNKNLEDFNEIVIATANELKRELTIANTSFVTSGPDFGSPDVKLIGNPKIAILRGEGTSS
LNYGEIWYFFEQELDYPVTAIGTDYFNRIDLDSYDILIIPEGYYASVLGDNSIKKIQDFV
RAGGKMITIGRAVGYFAGKDGFNIKQNHDEENKDDADKPNLTPYSMRQRESIKNNSPGSI
VKTTVDNTHPLAFGYDKTYFSLKLGSSNYGILSKGYNVAYMQEPQVVSGFVGSEAYKTLE
NSVVFAEENMGRGSVIYMVDNPLFRSFWQNGKLFFANALFMVK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaattactcctaattacctttacgatcctgagttttgtaaatgtaaaagca
caggtaaaatcaccctcagattttttaggatatgaacttggaagccaattttcaagacat
gccgatgttgtagattattttaaatatatcgcagaaaaatctcctttagttacttatcac
acttacggtaaaaccaatgaaagacgaccacttacctgtgccgtgatttctacaaaagaa
aatcttggaaacatcgaggaaatcagaaaaaatcacttgcgccaaaccggcatcttagac
ggcactcccacaaccgataaagccatcgtttggttaagttataacgtgcatggtaatgaa
gcatctagtacggaagcttcgatgaaaaccctttataatctaattactgaaaagcaggac
tggttaaaaaacaccatcgttattatcgatccttgtgtgaatcccgatggacgtgatcgt
tatgccaactggtataatcaggtaaagcaaacgccatttagtacttcacaagatgctgct
gaacattacgagccatggcccggtggcaggcctaaccattatttatacgacctaaaccgt
gattgggtttgggccacacaggttgaaacacaaagccgtttaaaaatctataatcagtgg
atgccgcatattcatgtcgattttcatgaacagggaattaacaacccctattattttgct
cccgcagccgagccattccatgatattattacgccttttcaaagagatttccagacaaga
attggtaaaaacaacgctaaatattttgataaagaaggatggttatttttcactaaagaa
agttttgatttgctttatccaagttatggtgacacctatccaacatatatgggagctatt
gggatgacctacgaacaggcaggtcatggccgtggcggattaggaatcaaaaccgaccag
ggttatattttaaccttaaaagaccgaattgaacaccattttactacaggaatatcgacc
atagaaatggcgtcaaaaaatgcagaagaactttcacaagaattcagtaattattttagc
gatcttgatagaaaatatcaaacttttgcacttaatggcgataaagacaaaattgatgct
ttaaaagaattattagatcgtcatgaaattaaatattctaacgccagatctggcgaaaaa
atatcagggtacagctttactgaaaacaaagatggaaatttaatcaccacacatcaaacc
ttactggtgagcacccaacaaccaaaaggacatatggttgaagtactttttgaacctaaa
acaaaattaaacgactcgatcacctatgacatcacggcatggagcttagcttatgcctat
ggtttaaatgctgttgcaagtactaaagcttattccggaaaaagtactacggaaacatcg
aatataaataatacagtaaatgctgaaggtgcaggatatatcgccaaatggaatagcatg
aaagatgccgaatttttagcggctttattaaagcagaatgtaaaagttaggtttagcgaa
cttcctttttcttcggaagggaaaaaatttagtgctggtagtttaattattacaaaaagt
gataataaaaatctcgaagattttaatgaaattgtgattgcaaccgcaaatgaattaaaa
agagaactgaccatagccaatacaagttttgtaaccagcggacccgattttggatctcca
gatgtaaaattaatcggtaatcctaaaattgccattcttcgcggtgaagggacttcttcc
cttaattacggggagatctggtatttctttgagcaggaattagattatcctgtaaccgct
atcggtaccgattattttaaccgaatcgatcttgattcttacgatattttaataattccg
gaaggttattacgcaagcgtgttaggtgacaattctataaaaaagatacaagactttgtt
cgcgctggtggaaaaatgatcaccattggaagagctgttggttattttgcgggtaaagat
ggttttaatatcaaacaaaatcatgatgaggaaaataaagatgatgctgataagccgaat
cttacgccttacagcatgagacaacgagaaagcattaaaaataatagtccaggaagtatt
gttaaaaccacagttgataatacgcatccactggcttttggatatgataaaacgtatttc
agtcttaaactgggcagtagtaattatggaatacttagcaaaggttataatgttgcttat
atgcaggaacctcaggtagtttctggatttgtaggaagcgaagcctataaaacacttgag
aattctgttgtttttgctgaagaaaatatggggcgcggtagcgtaatctacatggtagat
aatccattattcagatcgttctggcagaatggtaaattgttttttgctaatgccttattt
atggtaaagtag

DBGET integrated database retrieval system