KEGG   Zunongwangia profunda: ZPR_2936Help
Entry
ZPR_2936          CDS       T01216                                 

Definition
(GenBank) tonB-dependent Receptor Plug domain protein
Organism
zpr  Zunongwangia profunda
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec CarbopepD_reg_2 Plug CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ADF53256
UniProt: D5BGS5
Position
3174890..3177847
Genome map
AA seq 985 aa AA seqDB search
MLVCFNHEAQAKIVDFSHQNVQEPITGKVTSENDGMPLAGANIVVKGTQIATSTDFDGNY
TLDAPEGSILVVTYVGFATQEIAVGKDRVVNISLQEDTNALEEIVLIGYGKQKAGDVTSA
VANVKAEDFNKGQLTDAGQLIQGKVAGLAVTNANGDPTATSSIKLRGNNTLSGAYSDPLV
LIDGIPGALNTVAPEDIETIDVLKDGSAAAIYGVRGTNGVVLITTKRAKGAKINTVEYSG
YVSTAKIARELDFLSAGQFRELYPESDLGASTNWLDEITRTPITHVHNITLRGGSSQTNY
IANINYNSQQGIFLKSDNQTFRGRLEVNHKMFDDKLHLRFSLLGRENKYTSTGAGSSFRP
WIYYQAMRYNPTAPIKNEDGSWYQNISKLGYENPLSLIKESDGNVKTSEMRYVGTVTYNP
IEALTLNGNFSLTREPSTNGYSETLNHVSNIRDGFAGYSNIGGYTDTDRQIELTATYDKD
LENHEFSVLLGYSYLSNESEWYGMNNFGFQDDYFGGWHNIGVGNALQEGFAGMSSGKFKK
NLISFFSRVTYSYKDRYLLMASIRHEGASQLWGTNNAWGTFPAASIGWKITNEEFMSNQN
LFNEIKLRAGYGVTGSQPADSFLGIGMLKYGDYAYVNGQWLRTVVPASNPNPDLKWEEKR
ETNLGVDFSLKNGRLSGSIDAYERNVVGLLYSYNVSMPPYLYPTIMANGGNMVNRGIEVL
INTTPVETEDFSWNSTITYSVNENKLKSLNGSVFKTDYDFFDTGDVYYEGQTTRSHRVQV
GQSIGNFYGFRVTDVDQDGKWIYEDANGNPVAYDDFSHAPEDRHYIGNGIPKWYAGFNNT
FRYKNLDLTVNMRGAFNFQIINEARMNFEGTQNGYRDNRLSSVTDKVFGKTTLSPEVQAE
YNSYYVEDGDYWKIDNIALGYTIDKFNTEIIKSLRVYGSVNNAFTITGYNGIDPEVNTSG
LNPGIDRREKFPTVTTFTLGLSARF
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtatgtttcaaccatgaagcccaggcaaaaatagtagatttctcccatcagaat
gttcaggaaccaataacgggtaaggtgacttcagaaaatgatggtatgccattggccggt
gctaatattgtagttaaaggaacacaaatagcaacttctacagattttgacggcaactat
accctggacgctcctgaaggatctattttggtagtgacttatgtgggttttgctactcag
gaaatcgctgtaggaaaggatagagtagttaatatctccctgcaagaagataccaatgcc
ctggaagaaatcgtacttataggatatggaaaacaaaaagcaggagatgtgaccagtgct
gtagctaatgttaaagccgaggattttaataaagggcaactaaccgatgccggacaattg
atacagggaaaagttgctgggctggcggttaccaatgctaatggagatcctacagcaaca
agctcaatcaaattaagaggaaacaatacgctatctggtgcatattcagaccctctggta
cttatcgacggtataccaggagctttaaacacggttgctccagaagacatcgaaaccata
gatgttttaaaagatggatctgccgcagcaatatatggtgttaggggaacgaatggcgtc
gttttaattactacaaaaagagcgaaaggtgcgaagataaatacggtagaatattctgga
tatgtaagcactgccaagattgccagagaactcgattttttaagtgcaggacagtttcgg
gaattatatccggaatcagatttaggggccagtaccaactggctggacgaaatcaccaga
acccctataacccatgtgcataatattacgcttagaggaggcagttcacaaaccaattat
attgcaaacattaattataattcacagcaaggcatctttttaaagtcagataaccaaacc
tttagaggacgcttagaagtaaatcacaagatgtttgacgataaattgcatctgcgattt
tctttattaggaagagagaataaatatacctctaccggagcaggaagtagctttaggccc
tggatctactatcaggctatgcgttataatcccacagcacctattaaaaacgaagatgga
agttggtatcagaacatcagtaaattaggatacgaaaacccgctttccctaattaaagaa
tctgacggaaatgtaaaaacttctgaaatgcgttacgttggaacagtaacctataatcct
atagaagcgcttacgctaaatggtaacttctcgttgacaagggagccaagcaccaacggt
tattctgaaactttaaatcacgtttccaatataagggatggttttgcgggctactccaac
ataggaggctatactgataccgataggcaaatagagttaaccgcaacctatgataaagat
ttggaaaatcatgagttctcagtgcttttagggtacagctacttaagtaatgaaagcgaa
tggtatggtatgaataattttggatttcaggacgattattttggtggatggcataatata
ggcgttggaaatgcgcttcaggaaggttttgcaggaatgagttctggaaaattcaaaaaa
aatctgattagtttcttttctcgtgtcacctattcctataaagatagatacctgcttatg
gccagtatcagacatgaaggtgcaagtcagctctggggaaccaacaatgcctggggaact
ttccctgcagcttctattggttggaaaatcacaaatgaagaatttatgagtaaccagaat
ctttttaatgaaattaaattgagagcaggctatggggtgaccggttcccaaccagcagat
tcttttttaggtataggaatgcttaaatatggagattatgcctatgtaaatggtcaatgg
ttaagaactgttgttcctgcctctaaccctaatcccgatttaaaatgggaagaaaaaaga
gaaaccaaccttggggtggatttctcacttaaaaacggtcggctttcgggttcaatagat
gcttacgaacgcaatgtggtaggccttttatattcttacaacgtttctatgcctccttac
ctatatcctacgataatggccaacggtgggaatatggtaaatcgcggaattgaagttttg
attaatactacacctgtagaaaccgaagattttagttggaatagtaccattacctattct
gttaacgaaaataaattgaaaagcctaaatggcagtgtattcaaaaccgattacgacttt
tttgatacaggagatgtttattacgaaggacaaacgacaaggtcccatcgtgtccaggta
ggacaatctataggaaatttctatggattcagagtaacagatgtagatcaggatggaaaa
tggatatatgaagatgccaatgggaatcccgtagcttacgatgattttagccatgctccg
gaagaccgccattatataggtaatggtatccctaaatggtacgccggtttcaataacact
ttccgttataaaaacctggatttaacggtaaatatgagaggggcgtttaatttccagatt
ataaatgaagctagaatgaactttgaaggtactcaaaacggatatagggacaatcgtctt
tcttcggttactgataaagtattcggaaaaacaacgcttagcccagaagtacaggcagaa
tataatagttactatgttgaagatggagattactggaaaatcgataatatcgctttaggg
tatactatagataaatttaatactgaaattatcaaatctctaagggtatatggatcggtg
aataatgcatttacgataaccggctataatggtatcgatccagaagtaaatacttcagga
ttaaacccgggaatagatcgaagggagaaattccccaccgtaaccacttttactttaggt
cttagtgccagattttaa

DBGET integrated database retrieval system