KEGG   Zunongwangia profunda: ZPR_3206Help
Entry
ZPR_3206          CDS       T01216                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00562  Inositol phosphate metabolism
zpr00564  Glycerophospholipid metabolism
zpr00565  Ether lipid metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ZPR_3206
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ZPR_3206
   00565 Ether lipid metabolism
    ZPR_3206
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ZPR_3206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:zpr02042]
    ZPR_3206
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     ZPR_3206
Bacterial toxins [BR:zpr02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   ZPR_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: ADF53523
UniProt: D5BIB0
Position
complement(3489899..3492145)
Genome map
AA seq 748 aa AA seqDB search
MQENRSFDHCFGRLRGVRGFNDPRAIDTPTGLPVWYQRNNAGKTATPFRLDIKNTKSTWM
GSLPHGWEDMVAARNNGKMDKWLEAKKSGNPDYAKMPLTMGYYDREDLPFYYSFADAFTV
CDQSFCSTLTGTSPNRNYFWAGTVREDAHNPSSKAHVDNGMIDFKNVSWKTYPERLEEAG
ISWGVYQNELSIPTGLSGEEEFWLANFTDNDLEFIKQYNVRFHPQHRAWMQSELEKLLKI
ENSEKHSENEQKELTAKIANLRKDLEVYSEANFNKLSDHQKAIHNKAFITNKNYLEYRKL
EHLKFEEKELKVPKGDVLHQFRNDVDNGELPMVSWLVAPCAFSDHPGSPWYGAWYVSEVL
DILTKNPEQWKKTIFIVTYDENDGYFDHVPPFVAPKPGSGATNNIPTEEEFVDGKHNLGL
GFRVPMIVASPWSRGGYVNSEVFDHTSSLQFLEHFIEKKTGKKVIEENIGDWRRAICGNL
TSVFRDADSSVPKEMAVKRDAYIQQIYDAKEKKLPSDYKMLSDTDLRDLRNKDQLNKLLP
AQEPGTKPACALPYNLSLDCGYMASKDKLELTMSYQNTLSKSKKGAAPFQVYDMTSLLQD
AKRSCYDFTVSEGEHIKYDFPFHSDKFFIKAYAPNGFYREFRGHKNQLAATTIKLKTAGN
KERMRAVFQIDTKQKISVAIIDKSYNRKPVNVVLEKGTHQKEIDVHDSFGWYDYSILIAE
YPEFEQRFAGHIENGKTSTTDPLMGRSV
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaacaggtcttttgatcactgttttgggcgtttgcgtggtgtacgtggattt
aatgaccccagggcgatagacactcctactgggttgccagtgtggtatcagcgtaataat
gctggtaaaactgcaacgccatttcgtctggatataaaaaataccaaatccacctggatg
ggatcacttcctcatggttgggaagatatggtggctgcaagaaataatggtaagatggat
aaatggcttgaagccaaaaaatcagggaatcccgactatgccaaaatgccgttaacgatg
ggatattacgaccgggaagatcttcccttttattactcttttgcagatgcttttacggtt
tgtgaccaaagcttttgttctacgttaacgggtaccagtcccaatagaaattacttctgg
gcgggaactgttcgtgaagatgcacataatccttcttcaaaagcccatgtagataatgga
atgatcgattttaaaaatgtgagctggaaaacatatccagaacgccttgaagaagccggg
atatcctggggagtatatcaaaacgaacttagtattcccacaggtctgtctggagaagaa
gagttttggcttgctaactttactgataatgatttggaatttataaaacaatataatgtt
cgttttcacccccagcacagggcatggatgcagtcagaattagaaaaactgttaaaaatt
gaaaattcagaaaagcattcagaaaatgaacaaaaagaattaacggctaaaatcgccaat
cttaggaaagatcttgaggtgtatagcgaagctaattttaataagctaagcgatcaccaa
aaggcaatacataataaagcctttatcaccaataaaaattatctggaatatcgaaaactc
gaacacttgaagtttgaagaaaaggaacttaaagtgccaaagggagacgtgcttcatcaa
tttcgaaacgatgtagataatggggaattacctatggtatcctggttggtggccccatgt
gctttttcagatcatcccggttcgccatggtatggcgcctggtacgtatctgaagtattg
gatattttaacgaaaaatccggagcaatggaaaaaaacaatttttatcgttacctatgat
gaaaatgacggttattttgatcatgtacctccctttgtagcgcctaaaccgggaagtggt
gcgactaacaatatccctacagaagaagagtttgtagacggaaaacataatttaggttta
ggttttcgggtacctatgatagttgcctcaccatggagtaggggagggtatgtaaacagt
gaagtttttgatcatacctcctcgttacagttcctggagcattttatagaaaagaaaaca
ggtaaaaaagttattgaagagaatattggagattggagacgggctatttgtggtaacctt
acttcggtattcagggatgctgatagctcagtaccaaaagaaatggcggtaaaaagggac
gcctatatccaacaaatttatgatgcgaaagaaaagaaattgccttcggattataaaatg
ttaagtgataccgatttgagggatttaagaaataaagatcaacttaataaattattgccg
gcgcaggagccgggtaccaaacctgcttgtgctttaccttataatttgtcattagattgc
gggtatatggcttcaaaagataagttggaacttactatgtcctaccaaaatacgctatcg
aaatctaaaaaaggagcagcaccatttcaggtatatgatatgacttctttacttcaggat
gctaaaaggtcctgttatgattttaccgtaagtgaaggtgaacatataaaatatgatttt
cctttccattccgataagttctttatcaaggcttatgctcctaatggtttttacagggaa
tttcgagggcataaaaatcagcttgcagccactactattaaattgaaaacagcaggtaat
aaagaaaggatgcgtgcagtttttcaaattgatacaaaacaaaagattagtgttgctatc
atcgataagtcgtataatagaaaaccggtgaatgtagttttagaaaaaggaacccatcaa
aaggagatagatgtccatgattcatttggctggtatgattacagcattttgatagcggaa
taccctgagtttgaacaacgttttgccggccatatcgaaaatgggaaaaccagtactacc
gaccctttaatgggaagatcggtttaa

DBGET integrated database retrieval system