KEGG   Zygosaccharomyces rouxii: ZYRO0A06644gHelp
Entry
ZYRO0A06644g      CDS       T01118                                 

Definition
(RefSeq) mitochondrial 37S ribosomal protein MRP1
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04146  Peroxisome
zro04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:zro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ZYRO0A06644g
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    ZYRO0A06644g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ZYRO0A06644g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C DUF3847
Motif
Other DBs
NCBI-GeneID: 8201894
NCBI-ProteinID: XP_002494657
UniProt: C5DPW3
Position
A:complement(541958..542881)
Genome map
AA seq 307 aa AA seqDB search
MFRSSLSFLRTSRSYITPTLEHLNSGSGLKGLFSPQGLDNGWFSRAEHYTNKLNSLTNGI
EEIPLEKLIYENAKSGVKRNIVNYATLLYNLKFAFSTLHGCPKELPNASDIDVKELLKTP
ELTLKYANEPLDTGKEKLHSALVSSFGSIVEFRTLLLNSNNAISGDGFTWLVARRVASQD
FDSQKLEFDRLFILNTYNAGSPFNFNKKGHMDELKNQYEKASKELDQEQQEFNAPLRSKS
VEEARQMESFKDTEYLPLLAIDASPKAWLYDYGPYGKQMYLDRVWESIEWDLVESRLPEK
SQSHQLL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatccagtttatcattcctgcgtactagtcgtagttacattacgcctacatta
gaacatctaaactccggatctggtctaaaaggacttttttcacctcaaggtctggataac
ggatggttctctagagctgaacattataccaataaattaaactcattgacaaatgggatc
gaagaaataccattggaaaaattgatatatgaaaacgcaaaatctggcgttaaacgtaat
attgtgaattatgcgacattgttgtacaatttgaagtttgcattttccactttacacggt
tgtcctaaggaattacccaatgcatccgatatcgacgtcaaagaacttttaaagacacca
gagttaactttaaaatatgcaaatgaacccctagataccggaaaagaaaaattacactca
gcgctcgtatcatcattcggatccattgtggaattccgtactttactcctaaattctaat
aatgcaattagtggtgatggatttacgtggcttgtagcccgtagagttgcttctcaggac
tttgattcacagaaattggaatttgatcgtttgttcattttgaacacttacaatgcaggg
tctccatttaattttaacaaaaagggacatatggatgaattaaagaatcaatatgaaaag
gcgagtaaggaattggatcaggagcaacaggagttcaatgcaccactaagaagtaaatcc
gttgaggaagccagacagatggagtcatttaaagatactgaatatttaccactgttggca
attgatgcgtcaccaaaggcttggttgtacgattatggtccatatggtaaacaaatgtat
ctggatagagtctgggaatccattgaatgggaccttgtggaatcgaggttaccagagaaa
agtcaatctcatcaattgctatga

DBGET integrated database retrieval system