KEGG   Zygosaccharomyces rouxii: ZYRO0B04576gHelp
Entry
ZYRO0B04576g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
zro  Zygosaccharomyces rouxii
Brite
KEGG Orthology (KO) [BR:zro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:zro03021]
    ZYRO0B04576g
Transcription machinery [BR:zro03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     ZYRO0B04576g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med26 SRP54
Motif
Other DBs
NCBI-GeneID: 8202295
NCBI-ProteinID: XP_002495150
UniProt: C5DR06
Position
B:372194..373324
Genome map
AA seq 376 aa AA seqDB search
MSSEEPAQVVDSLASPEGPAGVDTNGTAETTTAAETAAAAAADRQRKHIEKSGSDDESDG
DADPEAEAAKNARIATNQQLDEIDNTHRNRQELEEKLDKIIKKPKARRSRRDEDDLEQFL
DEKILRLKDEMNVAAQIDVDTLNKRLETGDNSLIAMQKVKLLPKVESVLSKAHLADTILD
NNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALEKLPIKTEHLKESGLGRVIIFYTKSKRV
EPPLARLADRLIAEWTRPIIGASDNYRDKRILQLEFDAEKMRKKAALDSAKSRKKKSGKK
ITAQGSTSQSLYEQAAARRNRAAAPAPTTTDYKYAPTSNLNPTSGPSKIAGVGSSLNNSE
MYKRLTSRLQKGKRSK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgaagagcctgcacaggttgtagactctttagcgagtccagaaggtccagct
ggagtggatacgaacggaacagcagagacgacaacagcagcagagacagcagcagcagca
gcagcagatagacagcgcaaacatattgaaaagagtggtagtgatgacgagagtgatggt
gatgcagatccagaggcagaagcagccaaaaatgcacgtatagctacgaatcagcagtta
gatgaaatcgataacactcatcgtaatcgccaagagctagaggagaagctagataagatt
attaagaaacctaaggcaaggaggagtagaagagacgaagatgatttggaacagtttcta
gatgaaaagatcctaaggttaaaggatgagatgaatgttgctgcacaaatcgatgtagat
actttaaacaagaggttggaaaccggtgataactcattaattgccatgcagaaggtcaaa
ctattgcccaaggtggaaagcgtcctatctaaagctcatcttgcggataccatattggat
aataaccttttacaaagtgtaagaatttggttagagccattgccagatggatcgttacca
tcatttgaaattcaaaaatctttatttgccgcccttgagaagctgccaatcaagactgaa
catttaaaggaaagtggtttgggtcgtgtcataattttttacactaaatctaaacgtgta
gaaccaccattggccagattagcggatagattaattgcagaatggacaagaccaattatc
ggagcatctgataactatagagataagagaattttacagttggaatttgatgctgaaaag
atgagaaagaaggcagccttagattctgcaaagagccgtaagaagaaatcaggtaaaaag
attacagcccagggatcgacttcacaatcattatacgaacaagcagcagctcgcaggaac
agagccgctgcacctgcaccaactacaactgattacaagtatgctccaacgagtaatttg
aatcccacttctggtccttcaaagattgcaggtgttggttcatcgttgaacaacagcgaa
atgtacaagagactaacctcaagactacaaaagggtaaacgttctaaatag

DBGET integrated database retrieval system