KEGG   Zygosaccharomyces rouxii: ZYRO0B06754g
Entry
ZYRO0B06754g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00100  Steroid biosynthesis
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
Module
zro_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    ZYRO0B06754g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     ZYRO0B06754g
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DDE_Tnp_Tn3
Other DBs
NCBI-GeneID: 8202393
NCBI-ProteinID: XP_002495246
UniProt: C5DRA2
Position
B:540624..541934
AA seq 436 aa
MALNPKTRPIEFGGPAGVLGLALGLPIFTVFLNQMVRPDYYIRGFFCNFDFAQLWNGIKP
WHYYLTRYDLWTYYTVWFVSLAVMSVILPGKHMQGLPLRDGTKLPYKINGIAISSALALV
LSARWTLTGGQMPELQFLYDNHTDICIITILFSLVLSILCYLASFVPLLRGNNGVGTRER
ILAAPGHTGNCIYDWFLGRELNPRLGPLDVKLFCELRPGMLLWLLINLSCLHHVYLQTGQ
FNNSLILVNFLQGLYILDGVLNEEGVLSMMDIATDGFGFMLAFGDLTLVPFTYSLQCRYL
SVSPLVFSPYHIAAIIAVMTLGFYIFKASNHEKAMFRAGKLPHLKSIKTATGTSLLCDSW
WSLSQHTNYFGDWLVSLSWCLATGFQTPLTYYYSAYFATLLLHRQQRDSHKCRSKYGASW
QEYESKVPYKIVPYVY
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggctctcaatcccaaaactcgaccaattgaattcggtggacccgctggtgtgttgggt
ctggcattaggtttacccattttcactgtctttctgaaccaaatggttaggccggactac
tacattcgggggttcttctgcaattttgattttgcacagttgtggaacggtattaaacct
tggcattattatttgacacgctatgatctttggacttattacacagtttggtttgtttcg
ctggcagtaatgagtgtgattttaccaggaaaacacatgcaaggattaccattaagggat
ggtactaagttgccctacaagattaatggaattgccataagtagtgcattggctttggtt
ctctctgcccgttggactcttacagggggtcaaatgcctgaattgcaatttctttatgac
aatcatacagatatatgcattatcacaatcctattttcgttggttctttccatcttgtgc
tatttagcaagttttgtacctctgttacgtgggaataatggtgtgggtactagggagaga
atattggctgccccaggtcatacaggaaattgtatttatgattggtttttgggcagagaa
ttaaaccccagattgggacccttagatgtgaaattattctgtgaactacgtccaggaatg
cttctctggctcttaattaatctatcgtgcttacatcatgtttatttgcaaactggtcaa
ttcaacaactcattgatactggtgaactttttgcaaggtttatatatcctagatggggtt
cttaatgaggaaggggtgttaagcatgatggatatcgccacagatgggtttggattcatg
ttagcatttggcgatttgacactagtacctttcacctattcgttacaatgtcgttactta
agcgtttctcccctggtgttttccccatatcacattgctgccatcattgctgtcatgact
cttggtttctacatcttcaaggcatctaaccatgagaaggctatgttccgtgcaggtaaa
ctacctcatttaaaatcgattaaaactgctactggaacttctctactgtgtgatagttgg
tggtcactttcacaacatactaactattttggtgattggctagtctctctgtcctggtgc
cttgcaacgggcttccaaactcctttgacctattactactctgcttattttgccacactc
ctattgcaccgtcaacaacgtgatagtcacaagtgccgttcgaaatacggtgccagttgg
caagagtacgaatctaaggttccttacaagattgtaccctacgtatactaa

DBGET integrated database retrieval system