KEGG   Zygosaccharomyces rouxii: ZYRO0B12386gHelp
Entry
ZYRO0B12386g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K10577  ubiquitin-conjugating enzyme E2 I
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro03013  RNA transport
zro04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:zro00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    ZYRO0B12386g
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ZYRO0B12386g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:zro03019]
    ZYRO0B12386g
   04121 Ubiquitin system [BR:zro04121]
    ZYRO0B12386g
Messenger RNA biogenesis [BR:zro03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     ZYRO0B12386g
Ubiquitin system [BR:zro04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   ZYRO0B12386g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD
Motif
Other DBs
NCBI-GeneID: 8202643
NCBI-ProteinID: XP_002495481
UniProt: C5DRY7
Position
B:complement(1001376..1001849)
Genome map
AA seq 157 aa AA seqDB search
MSSLCLQRLQEERKKWRKDHPFGFYAKPCKKADGSMNLQKWEAGIPGKEGTIWQDGVYPI
TIEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIALGVQDLL
DSPNPNSPAQEPAWRAFLRNRADYDKKVATQAKQYTK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtctctgtctacaacgtttacaagaggagagaaagaagtggaggaaagaccat
ccctttggattttatgccaaaccatgcaagaaggcagatggttccatgaatctgcagaaa
tgggaagctggtatacctgggaaagaaggtaccatttggcaagatggtgtttatccgatc
actattgaatatcctgatgaatacccatctaaaccacccaaagtcaagtttccggctgga
ttctatcatccaaatatctatccaagtggtactgtatgtctaagtatattgaatgaagat
caggattggagacctgcaatcactttaaagcaaattgcccttggtgtgcaagatcttttg
gattcgcccaacccaaactcacctgctcaagaaccagcttggagggcatttttaagaaat
agagctgattacgataaaaaggttgctactcaagctaaacagtacaccaaatga

DBGET integrated database retrieval system