KEGG   Zygosaccharomyces rouxii: ZYRO0D00330g
Entry
ZYRO0D00330g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 8203692
NCBI-ProteinID: XP_002496449
UniProt: C5DWW5
Position
D:complement(22470..24866)
AA seq 798 aa
MSSGLDFKEPALEDTQVLGRSHSSNADTTMSETHEIKNYDARSGTESDLPKELTQVKVEE
VTLTETPEGVDDIWEGDPSEMPDSPYPEVRAVLSPTDDPSIVLNHWRTWFLVTVFVVVFA
GVNQFFSLRYPSLTIDFLVAQVICYPLGKTLACLPDWKCKLVPFFNLNPGPFTKKEHAVV
TIAVALTSSTAYAMYILNAQVSFYNMSVNSGYQLLLVWSSQMLGYGAAGLTRRWVVNPAS
CIWPQTLISVSLFDSLHSRTIEKSSVNGWKVPRYKFFLFVLIGSFVWYWVPGFLFTGLSY
FNIVLWGPKTRHNFVLNTIFGVSSGIGALPISFDYTQISQAMTGSVFATPFWVSANTYAS
VLIFFVFLLPILYFTNTWYAKYMPVISTSTFDNTQKKYNVTRILNPDFTVNLEKYKSYSP
LFVPFSYLLSYALNFAAVIAVFVHCGLYHGKDIYGKLKDANFGGSDIHRRLYQQNYKDCP
DWWYLVLQVIMLGLGFAAVCGFDTHFPAWAFVVALLIAFANFIPQGILEAITNQHVGLNV
ITELVCGYMLPFRPMANLLFKLYGFIVMRQGLSLSRDLKLALYMKIPPRLIFCIQIYATI
VSGLVNVGVQEWMRHNIKDFCSPDQSNGFICANGRTVFNASIIWSMPKYLFSSGRIYNPL
MWFFLIGLGLPLAIFGLQLLLPKVNFLKYIHTPIFFAGPGNIPPSTPYNYSLFFAMSFWL
YIIRRRWPLWFKKYNFVMGAGVEAGVAISVLVIFLCVQYPGGTLKWWGNDVWKNTYDYQS
KKYYTVKAGDKFGYDKWW
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgagtagcgggcttgattttaaggaaccagcgctcgaagatactcaggttttgggacga
tctcacagcagtaatgcagacactacgatgagtgagacacatgagataaagaactatgat
gcaaggagcggcaccgaatccgatcttcctaaggagctcactcaggttaaggtagaagag
gtaacgcttactgagacgccggaaggcgttgatgatatatgggaaggagatccctctgaa
atgccagattcaccttatccagaggtaagagcagttttatcacccacagatgatccaagt
atcgtcctgaaccactggagaacatggtttcttgtgactgtgtttgttgttgtcttcgct
ggtgttaaccagttcttttctcttaggtatccttcccttacgatcgactttcttgtagca
caggtcatttgctatccgttaggaaagacattggcatgtcttcctgattggaagtgtaag
ctcgttccgtttttcaatctgaatccaggaccctttacgaaaaaggagcatgcagtggtt
acaattgcggtggcattgacttcatctacggcttatgccatgtatatcctgaatgcgcag
gtgagcttctacaatatgtctgtaaacagcggttaccagttgctgttggtgtggtcatca
caaatgctgggatacggtgccgctggactgaccagaagatgggtggtgaatccggcctcg
tgcatatggccccagactctaatttctgtgtcgctgttcgactcattacactccagaacc
atagaaaaaagttcggttaacggatggaaggtacctcgctataaattctttcttttcgtc
ttaattggaagtttcgtgtggtattgggtcccgggtttcttgtttaccggtctctcttat
ttcaacatcgttctttggggccccaaaacgagacacaacttcgtgcttaatactatcttt
ggggtctctagtggaatcggggctctaccaatttcattcgactatacgcaaatatcccaa
gccatgacaggatcagtctttgctactccattttgggtttctgccaacacttatgcatca
gtcctcattttcttcgtctttttattgccaatcctttatttcacgaatacttggtacgca
aagtatatgcctgttatttccacttctacttttgataacacacagaaaaaatacaatgtg
accaggattttgaatccagattttaccgttaatttggaaaaatataagagttattcacca
ctctttgttccattttcctaccttctttcctatgcgttgaactttgccgcagttatagcg
gtgttcgtccattgcggtctctatcatggtaaagacatatatgggaaattaaaggacgcc
aacttcgggggcagcgatattcacagaagactataccaacagaattataaggactgtccg
gattggtggtatctcgtcctgcaggttattatgctaggtttgggatttgccgcagtatgt
gggtttgacacgcactttccagcatgggcctttgttgttgccctactcatagcctttgct
aatttcatcccccagggaatcttagaggctattaccaaccagcacgtagggctcaatgtg
attactgagttagtctgcggttatatgttgccctttcgccccatggcaaatcttttgttc
aaactgtacggtttcatagtgatgcgccaagggctctcactcagcagggatttaaaactt
gccctctacatgaaaattccaccacgtctaatcttttgcattcaaatatatgccactatc
gtatcaggtttggtcaacgtaggtgttcaggaatggatgaggcacaacatcaaggatttc
tgttcaccagaccaaagcaatggattcatctgtgcaaacggacggacggtgttcaacgca
tcaatcatttggtctatgccaaagtacctcttcagttctggcagaatatacaaccccttg
atgtggttttttctaatagggctcgggctgccgctcgctatctttggtctccaattgctg
ttgcctaaggtcaacttcttaaagtacatccatactcccattttcttcgctggacccggt
aacatcccaccaagtactccttacaattattcacttttcttcgcaatgtccttctggtta
tatatcatccggagaagatggccgctatggtttaagaagtataattttgtgatgggagct
ggggtagaggcaggtgttgcaatttctgtcttagtcatatttctgtgtgttcaataccct
ggcgggaccttaaagtggtgggggaacgacgtttggaaaaacacctacgattaccagtcg
aaaaagtactataccgtgaaggcaggagataagttcggctatgataagtggtggtaa

DBGET integrated database retrieval system