KEGG   Zygosaccharomyces rouxii: ZYRO0D14938gHelp
Entry
ZYRO0D14938g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00430  Taurine and hypotaurine metabolism
zro00460  Cyanoamino acid metabolism
zro00480  Glutathione metabolism
zro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ZYRO0D14938g
   00460 Cyanoamino acid metabolism
    ZYRO0D14938g
   00480 Glutathione metabolism
    ZYRO0D14938g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:zro01002]
    ZYRO0D14938g
Enzymes [BR:zro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     ZYRO0D14938g
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     ZYRO0D14938g
Peptidases and inhibitors [BR:zro01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   ZYRO0D14938g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 8204345
NCBI-ProteinID: XP_002497079
UniProt: C5DWH7
Position
D:1254317..1256140
Genome map
AA seq 607 aa AA seqDB search
MWLGILCLVATTVRALQVQFDSISNDIGNRDDHNIDIDPLPRQPSLTPDPKLLKIGDHGA
ISSDLEICGNLTVAQVLQKFPESNAADAAVTETLCIGMVNFFNSGIGGGGYAVFANPNED
EQLFLDFRERSPNGSHKEMFKSCPDCSKQGGLAVAVPGELRGLYTLYKERGSGKVGWYHL
IEPVAQLGYKGWEITDVLGAALEAYEPALLKRARDWKFVLNSTGDGVKKTGDWIRRPQLA
DTLMVLARNGSDAPFYDPNHWIAQSMVDTVQRNGGIMQLEDLQDYFVTMDNPLKLKIRSG
FQYAPDNDLTVLTSSGSSSGAALISALSILDKFGSQVGGDYTDKPTFQLVETMKWMASAR
SRLGDYGTNSIPRQVQDVLSSNWTEMAVNSIEDCNLKTFPNWTYYKPAYEINEPHGTSHV
SIVDSHNNAVSLTTTINLLFGSLVHDPITGIVFNNEMDDFSQYDRSNSFGLAPSRYNFPT
PGKRPLSSTAPTIILNELGLPDLIVGASGGSRITTSILQTIVRSYWYNMPLLEAIAYPRV
HHQLLPDLLEVENLTMVGSQSIRSLQEMGYNILEQSPKSCVNAIRNYRAAWHAVSDYWRK
RGISAVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcggaatcttgtgcttagttgcaacgacagtacgagctttgcaggtccaattt
gatagtatttccaacgatataggtaatcgtgacgatcataatatcgatatagatccattg
ccacgtcaaccttcactaacaccagatcccaaattgttaaagattggtgatcatggtgct
attagttcagatttagagatttgtggtaatttaacagttgctcaagtattacaaaaattt
ccagaatcaaatgctgcagatgctgctgtaactgagaccctctgtattggtatggttaat
ttctttaatagtggtattggtggtggtggttatgcagtatttgctaatccaaatgaagac
gaacaactattccttgattttagagaacgttcccccaatggctctcataaggaaatgttt
aaatcatgtcctgattgttcaaaacaaggtggtttagctgttgcggtccccggtgaactt
cgtggtctttacacattgtacaaggagcgtggtagcggtaaagtgggctggtaccacttg
attgaacctgtggcacagttagggtataaaggttgggaaatcactgacgtattgggagcg
gcattagaggcttacgaaccagcattattgaaaagggctagggattggaaatttgttctc
aactccacaggagatggtgttaaaaagacaggtgattggattaggagacctcagttggca
gataccttaatggttttagctcgtaatggttcagatgcacctttttacgatccaaaccat
tggatagctcaatcaatggttgacacagtacaaagaaacggcggtattatgcagttggaa
gatttacaagattattttgttacaatggacaatccgctaaaactaaagattagatcaggt
ttccaatatgcacctgataacgatttaacagttttaaccagtagtggatctagttcgggt
gctgcattgatatctgcattatctattttagataaatttggaagtcaagttggtggtgat
tatactgataaacccacttttcaattagtggaaactatgaaatggatggcaagtgctaga
agtagattaggtgattatggaacaaatagcatccctcgccaagttcaagatgttctctct
agtaactggactgaaatggctgttaatagtattgaagattgtaatctcaagacttttccc
aactggacttactacaaacctgcatacgagataaacgaaccacatggaacttctcatgtt
agtatagtggattctcataacaacgcagtttccttaactacaacaataaatttgttgttt
ggttcattggtacatgaccccattacaggtattgtatttaataatgaaatggacgatttt
tcacagtacgatagatctaacagttttggattagcaccatctcgttacaatttccccaca
cctgggaagagaccgttatcatcgacagcccccacgattattctcaacgaattgggcctg
ccagatttaattgttggtgcatccggtggatcgagaattaccactagtatcttgcagaca
attgtgagatcttactggtacaatatgccattgttagaggcgattgcctacccaagggtt
caccatcaactgctgccagatctactagaggttgaaaacttaacgatggtcggatcccag
tctattcgctctctgcaagagatgggttataacattttagaacagtcacccaaaagctgc
gtcaatgctattcgtaactatagagcagcatggcatgcggtaagtgactactggaggaaa
aggggcatttctgcagtatactaa

DBGET integrated database retrieval system