KEGG   Zygosaccharomyces rouxii: ZYRO0D15004gHelp
Entry
ZYRO0D15004g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00500  Starch and sucrose metabolism
zro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ZYRO0D15004g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     ZYRO0D15004g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase Importin_rep
Motif
Other DBs
NCBI-GeneID: 8204348
NCBI-ProteinID: XP_002497082
UniProt: C5DWI0
Position
D:1261396..1262745
Genome map
AA seq 449 aa AA seqDB search
MLLSSIALLMEAVVGFCSPVSKGEQKSGSETTNVQFLTERNQKRYFDYGSTEWNEPIRGV
NLGGWLVLEPFITPSLFEVFRENDNSDEGIPVDEYHYTKALGPELAANRLEAHWQSWITE
KDLTAIKSMGFNLVRIPIGYWAYETLSDDPYVSGHQEKYLDEAIEWASNNGLKVWVDLHG
AAGSQNGFDNSGLRDSYKFQDEENLNVTRKVIHYLLDKYSRDEYVDTVIGVQLINEPLGP
VLDMDKLKNDYYLENYNYLRQELGRDQIIVIHDAFQPLHYWDDFLTEDQGYWGVLVDHHH
YQIFDSNQLNATFEDKLKLACSWGQDIVNESHWNVAGEFAAALTDCTKWVNGVGYKARYD
GSYQKDNQGSFYIGSCENNEDFSSWSQDRKDQARHYLETQLNAFELRGGWILWTYKTENS
IEWDAQKLAYNGVLPQPLDDRKFPNYCKK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctattatcctcaattgcacttttgatggaagctgtggttggtttctgttctcctgtt
tccaaaggagaacagaaatctggatctgaaaccaccaacgttcagtttctaactgaacgt
aaccaaaaaaggtacttcgattacggatccactgaatggaatgagcccattagaggtgtg
aatctaggaggttggcttgtgttagaaccttttattacgccatcgttatttgaagtattt
cgtgaaaacgacaatagtgatgaagggattcctgttgatgagtatcactatacaaaggca
ttgggtccagaattggcagctaaccgtttggaagcacattggcaatcttggattacggaa
aaggatcttactgcaattaaaagtatggggttcaatttggttagaatccctatcggttat
tgggcatatgaaactttgtccgatgatccatatgtttctggtcatcaagaaaaatactta
gacgaggctattgaatgggcttctaacaatgggttaaaggtttgggttgatcttcatgga
gctgctggttcacaaaatggatttgataattcaggcttaagagatagctataagtttcaa
gatgaggaaaatttgaatgtgactagaaaagttattcattatctattggacaaatattct
cgtgacgagtatgttgatactgtcatcggtgttcaattgataaatgaaccattggggcct
gttcttgatatggataaattgaaaaatgattactacttggaaaattataactatttgaga
caagaattgggtcgtgatcaaattattgtaattcatgatgcatttcaaccgttacactat
tgggatgatttccttaccgaggatcaaggttattggggggttctagtggatcatcatcat
taccaaatatttgactcaaaccaattaaatgcaacttttgaagataaattaaagttagca
tgttcttggggtcaagatatagttaatgaatcccattggaatgttgccggtgaatttgca
gctgctctgacagattgtaccaaatgggttaatggtgtcggttataaagcacgttatgat
ggtagttaccaaaaggataatcaaggctcattttacattggatcttgtgaaaataatgaa
gattttagttcgtggtcccaagatcgtaaggaccaggcaaggcattacttggaaacacaa
ttaaacgcattcgaactaagaggtggttggatcttgtggacctataaaacagaaaatagt
atcgaatgggatgctcaaaaattggcatacaatggagtgttaccacaaccattggatgac
aggaaattccccaactattgcaaaaagtaa

DBGET integrated database retrieval system