KEGG   Zygosaccharomyces rouxii: ZYRO0D15180gHelp
Entry
ZYRO0D15180g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:zro00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ZYRO0D15180g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zro03041]
    ZYRO0D15180g
Enzymes [BR:zro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     ZYRO0D15180g
Spliceosome [BR:zro03041]
 Complex C
  Other components
   Step II factors
    ZYRO0D15180g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE AAA_30 AAA_19 SRP54 AAA_14 AAA AAA_7 ABC_tran AAA_23 AAA_16
Motif
Other DBs
NCBI-GeneID: 8204356
NCBI-ProteinID: XP_002497089
UniProt: C5DWI7
Position
D:1274586..1277897
Genome map
AA seq 1103 aa AA seqDB search
MSDIDGKLFEIVGTDDELIINFIRDVKRNSQNIQDFETKIGKMDVGLSSEAIREIYDVLA
AGAGDKDNVREQVSKLLKTSVGIDDQVVVKFLLGIVDKTDSENEFCQELDKLDCGIPQSI
ASKIYWVARGDAKVKLEEEADKGLALPNFRAKYDDLSDPRDLLPKKKNPFLSHRDPGPIL
NKIYPGRIKNITAFGCFVQIHGTQEKNSDGLVHISEMTNHRVRRPQDLVQLGQEVFIKVI
KLQKNGNVSLSMKNIDQLTGQEIAADEPINEMRGRRDQVQNQSGVQRRPLTSPERWEIRQ
LIASGAASAEDYPELNQPKTNAVVNTQEHKQQEEQVDVELNTEDEPAFLKGETERGQQKA
EAPIKNVKIAKGSMNRVATNGSNLMKTHREEKSKLKKEIERRIRQKQALDDPTTDTATQR
REVDQLKQQLVLTAWERSRMKEDLTFGKQNTLPLSDQRKSLPVYGMREELIQAVEDNQFL
VIVGETGSGKTTQITQFLNEVGFGEHGIIGCTQPRRVAAVSVAQRVAEEVGCRVGNEVGY
TIRFEDRTSENTRIKYMTDGMLQREALLDPKMSRYSVIMLDEAHERTVATDVLFALLKQA
AVQRPDLKVIVTSATLDSVKFSEYFHNCPVKHIPGKTYPVDVVYSSEPQMDYLEAALDCV
MQIHVNEDPGDILVFLTGQEEIDSCCEILYQRVKILGKSIDELLILPVYSALPSEIQSKI
FEPTPAGSRKVVFATNIAETSITIDGIRFVVDPGFAKINIFNSRTGMEQLVVSPISQAQA
NQRKGRAGRTGPGKCYRLYTELSFRNEMLPNAIPEIQRQNLSHTILLLKAMGINDLLHFD
FMDPPPRNLLIGALEELFNLEALEEDGYLTKLGSRMSQFPTEPTLSRALLSSVTNNCSEE
IITIISMLSIPGVFYRPRDKQQDADNKKIRFHHPYGDHLTLLNVYQRWQLANCTEQFCTA
HYLQYRHLRRARDVRNQLTTIFRKLQLPIVSCRGDHDIIRRTLVYGFFMNAAKRDSHVGY
KTISGEIPVVIHPSSSLHGREHEYVIYHSLLLTTREYMSQVTAIDPSWLLEAAPHFYKVA
DESKKRAKITPMFQRHNAKRIRR
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcgatggtaaattgtttgaaattgtcggtacagatgatgagctgatcatt
aatttcatcagagatgtcaagaggaactctcaaaatatccaagatttcgagaccaaaatt
ggtaaaatggacgttggattatccagcgaagccattagggaaatctacgatgttttagct
gccggagctggtgataaggataatgtcagggaacaagtgtcaaagcttttgaagacatcg
gtgggaattgatgatcaagtagtagtgaaatttctattgggaatcgtcgataaaacagat
tcggaaaacgaattctgtcaagaattggataaattggattgtggaattccacaatctata
gccagtaaaatatactgggttgctagaggcgatgctaaagtcaaactggaggaggaagca
gataaaggattggcgctcccgaatttcagggccaaatatgatgacctgagtgatcctaga
gatcttctgcctaagaaaaaaaatccatttctcagccatcgcgatccaggacccattcta
aacaagatataccctggtaggattaagaatatcacggcttttggttgctttgtacaaatt
catggtacccaggaaaaaaattctgatggattagttcacatttcagagatgacaaatcat
agggtgaggagaccacaggatttggtacaattgggacaagaggtattcatcaaagttatt
aaattacaaaaaaacgggaacgtttctttaagcatgaaaaacattgatcagctaacgggg
caagagatagccgccgatgaaccgatcaacgaaatgagaggaagaagagatcaagtgcaa
aatcaaagcggagtgcaaagaagaccgcttacttcgccagagagatgggaaatcagacaa
cttattgccagtggagccgcttcggctgaagactatcccgaattgaatcaacccaagaca
aatgcagtagtcaacacccaagagcataaacagcaagaggaacaagttgatgtggaattg
aatactgaagacgaaccagcttttttgaagggagaaactgaaagagggcaacaaaaagct
gaggcgcctatcaaaaatgtcaagatcgcaaagggctcaatgaatagggtggccaccaac
ggttcaaatttaatgaaaacacatagagaggagaaatccaaattaaagaaggagattgaa
agacggatacggcaaaagcaagcactagatgatccaactacagatacagcaacccaaaga
agggaagtagatcaattgaagcagcaattggtgttaacagcatgggaaagaagtaggatg
aaagaagacctcacctttggtaagcaaaacacactacctctaagtgaccaaagaaagtct
cttcctgtatatgggatgcgagaggaattgattcaagcggtggaagataatcaatttctt
gttattgttggtgaaactggttcaggtaagacaactcaaatcactcagtttttgaatgaa
gtggggtttggcgaacatggtataatcggatgcactcaaccaagaagagtggctgctgta
tctgtggcccaaagggtggcagaagaagtagggtgtagagttggtaatgaagtcggttat
accatcagatttgaagacagaacttcagaaaatacccgtattaagtacatgactgatggt
atgttacaaagagaagcactgttggatccaaagatgtctcgttattcggtaatcatgctt
gatgaagcgcacgaaagaacagtggccacagatgttttatttgcacttttaaagcaagca
gcagtccaaagaccagatttgaaggtgattgtgacttctgctacacttgattctgtcaaa
ttttctgaatatttccacaattgtcctgtaaagcatatacctggtaagacctaccctgtg
gacgtagtttactcttcggaacctcaaatggattacctagaagcagctcttgattgcgtg
atgcagattcacgttaacgaagatcctggtgacattctagtctttctgacgggtcaagag
gagattgattcatgttgcgaaatcctctatcaaagggtaaagatcctgggtaagagtatt
gatgaactgctgattttacctgtgtattcagcattaccaagtgaaattcaatccaaaata
tttgaacccactccggcaggatccagaaaagtagtattcgccactaatatcgctgaaacc
tcaattactatcgacggtattcgcttcgtggtggacccagggtttgccaagataaatatt
tttaactctagaaccggtatggaacagctggtagtatcgcccatttctcaagcacaagct
aaccaaagaaaaggtagagcgggacgtacaggcccaggtaaatgttataggctttacacg
gaactatctttccgcaatgagatgttacccaatgcaatcccagaaattcagcgtcaaaat
ctatctcatactatcttactgttaaaggccatggggattaatgatctcttacactttgat
tttatggatccacctccaagaaatttgttaattggagctttggaagaactttttaactta
gaagcattggaagaagatggatatttaaccaagctagggtcaagaatgtcgcaattcccg
acagaacccacattgtcaagagcgctactcagctccgtaactaacaactgttctgaagag
attataaccataatttctatgctttccataccaggagtattttatcgaccacgagataaa
cagcaagatgcagataataaaaaaatcagattccatcatccttatggtgaccatttgaca
ctattaaacgtttaccaacggtggcaattagctaattgcacggaacaattttgcacggca
cactatttacaatacaggcacttgaggcgtgctcgggacgttagaaaccaattgaccacc
attttccgtaaattacaactgcccattgttagctgtcggggtgaccacgatatcattaga
agaactttagtatatggatttttcatgaacgccgcaaaaagagattcacatgtcggttac
aagaccatcagtggagagatcccagtcgttatccacccctctagctctctgcatggtaga
gagcacgagtacgtcatctaccactctttactgcttaccacaagggagtacatgtctcaa
gtgacagctattgatccaagttggttactagaagctgctccccatttttacaaagtggct
gatgaatcaaagaaaagagccaagattactcctatgttccaaagacataatgctaaaaga
atccggaggtag

DBGET integrated database retrieval system