KEGG   Zygosaccharomyces rouxii: ZYRO0F12078g
Entry
ZYRO0F12078g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K17292  tubulin-specific chaperone A
Organism
zro  Zygosaccharomyces rouxii
Brite
KEGG Orthology (KO) [BR:zro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:zro04812]
    ZYRO0F12078g
   04147 Exosome [BR:zro04147]
    ZYRO0F12078g
Cytoskeleton proteins [BR:zro04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     ZYRO0F12078g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZYRO0F12078g
SSDB
Motif
Pfam: TBCA DUF2046 TMF_TATA_bd Fzo_mitofusin
Other DBs
NCBI-GeneID: 8205491
NCBI-ProteinID: XP_002497725
UniProt: C5DYD1
Position
F:982214..982534
AA seq 106 aa
MAPTQLEIKVRALQRLVKEEAYYQEELKEQTAHVESMKADKDVDIYDLKKQVEVQQDTEK
LLPTLYKKIEEFRDNLEEFLKNYEGTEEVGDAHGAIDAANNLLASR
NT seq 321 nt   +upstreamnt  +downstreamnt
atggcacctactcaattagagataaaagttagagccttacagaggctagttaaggaagaa
gcttactaccaagaggaactgaaagagcaaacggctcatgtggaaagcatgaaagctgac
aaagatgttgatatctacgacttgaagaaacaagtagaggtacaacaggacactgaaaaa
ttgctccctactctttacaaaaagatcgaagagttcagagacaatttggaagaatttttg
aagaattacgagggaacggaagaagtcggtgatgcacatggtgcaatcgatgctgctaat
aatttgttggcatcaagatga

DBGET integrated database retrieval system