KEGG   Zygosaccharomyces rouxii: ZYRO0G03410gHelp
Entry
ZYRO0G03410g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00010  Glycolysis / Gluconeogenesis
zro00071  Fatty acid degradation
zro00350  Tyrosine metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0G03410g
  Lipid metabolism
   00071 Fatty acid degradation
    ZYRO0G03410g
  Amino acid metabolism
   00350 Tyrosine metabolism
    ZYRO0G03410g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZYRO0G03410g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 adh_short Epimerase
Motif
Other DBs
NCBI-GeneID: 8205939
NCBI-ProteinID: XP_002498150
UniProt: C5DZD3
Position
G:complement(269170..270291)
Genome map
AA seq 373 aa AA seqDB search
MLRFSQTLSGLKRVGQLRLQSSFTIPKVQKGVIFNKFGGPLLYREDLPVPTPASNEVLIN
VKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGKDVKTFEIGDLAGVKQLVSS
CMGCESCEIGHEFGCEQAEMSGSSHDGTFQQYVAIDALQAPPLPANVDLAAVAPIFCAGV
SVYKALKNGNLQTNQWVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGG
EVFLDYTQVDNIPAAVKQATQGGAHCVLNVTASLAAYDQTIKCVRPLGTVVPVGVPPDSG
LLKTDIFTIVQHGFSIKGSASGSRADTREAVDFFTRGLIKSPIKILGLSELPKAFELLES
GQTTGRLVLDTSK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttttagccaaaccttgagcggtttgaaaagggtcggtcaattgagattgcaa
tccagctttacaatccctaaagtgcaaaaaggtgtcatcttcaataaatttggcggtcct
ttactatatagagaagatctacctgttccaacgcctgcaagcaatgaagttttaatcaac
gtgaaatattccggagtttgccatacggatttacatacatggaagggtgaaatcccattc
aagactaaattaccactagttggtggtcatgaaggtgctggtgttgtggtcgccaaaggt
aaagatgtgaaaacttttgaaattggcgaccttgccggtgttaaacagttagtcagttca
tgtatgggatgtgaatcatgtgaaataggccacgagtttggttgtgagcaagcagagatg
tctggttccagtcacgacggtacatttcaacaatacgtcgctatcgatgcactacaagcc
cctccactaccggctaatgtggacttggcagctgttgcgcctatattctgtgcaggtgtc
tccgtctacaaagccctgaaaaacggtaacctacagactaatcaatgggttgctatcttt
ggtgcaacaggcggtctaggttccattgccgttcaatatgccaaggccatgggttatagg
gtgcttggtatcgatggtcctggtgaagagagaaaacaattattccattcccttggcggt
gaagtgtttttagattacactcaagtagataatattcctgctgctgtcaaacaagctacc
caaggtggtgctcactgcgtcttaaacgtcactgcttctctagccgcctacgatcaaacg
attaaatgtgtgagaccattgggaactgtggtccctgttggtgtaccaccagatagtggt
ctgctaaagacagatatctttaccatagtgcagcatgggttttccatcaaaggatctgca
tctggtagcagagcagacaccagagaagcagtagatttctttacaaggggcctcattaag
agtccaattaagatcttaggtttaagtgaattgcctaaagcgtttgaactgctcgagagc
ggtcaaactacgggcagactcgtcttagacacttctaaatga

DBGET integrated database retrieval system