KEGG   Zygosaccharomyces rouxii: ZYRO0G11154gHelp
Entry
ZYRO0G11154g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00760  Nicotinate and nicotinamide metabolism
zro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ZYRO0G11154g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     ZYRO0G11154g
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     ZYRO0G11154g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 8206284
NCBI-ProteinID: XP_002498474
UniProt: C5E0A7
Position
G:894075..895475
Genome map
AA seq 466 aa AA seqDB search
MDPTKAPDFKPTDSKSRPEPPPDPISTIPKSSPIVPYVLADYNSSIDAPFNLETAFKGRT
KSKTRPPAPPPSEARTPASDTGGVGVGVGSSSGSSSRAPHSHYQLHPYHRHRGGHRNPEE
KEQHRRASHIPMNTTDFQPLSAEISSTEEEEDTEGNEEELAEGIDSRLNLDDDPEKEEKS
GGISVGVRKNQIADLEEVPHGIVRQARNLDDYEFPTHRLAKKLKNPNKMPLVIVACGSFS
PITYLHLRMFEMALDAIREQTRFEVIGGYYSPVSDNYQKPGLAAASHRVRMCELACERTS
SWLMVDAWESLQPTYTRTAKVLDHFNYEVNVKRGGVSTVTGEKMGVKIMLLAGGDLIESM
GEPNVWADADLHHILGNYGCLILERTGSDVRSFLLSHDIMYQHRRNVLVIKQLIYNDISS
TKVRLFIRRNMSVQYLLPNSVIRYIQEHGLYVNQTESVKQVMGTKD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggatcctacaaaggcacctgattttaaaccaacggattctaaatcgagaccggaacca
ccaccagatccaatttcaacaattcctaaatcgagtcctattgtaccttacgttttagct
gactacaactcatcgatagatgcaccattcaatttagaaactgcattcaaaggaagaact
aaatcaaaaacaagacctcctgcaccaccaccatcagaggcaaggacaccagctagtgat
actggtggtgttggcgttggtgttggtagtagtagtggtagtagtagtcgtgcccctcat
agtcattatcaactacatccataccatcgccatcgtgggggccataggaatccagaggag
aaagaacaacatcgtagagcaagtcacatcccaatgaatacgactgattttcaaccatta
tctgctgaaatatcatcaacagaagaagaggaagataccgaaggaaatgaagaagagctt
gctgaaggaattgactcaaggttaaatttagacgatgaccctgaaaaggaagaaaaaagt
ggtggtattagtgtaggagtacgaaagaatcaaattgcagatttagaagaagttcctcac
ggaattgtccgccaagcaagaaatttggatgattatgaattccccacgcatagattggct
aaaaaattgaaaaatccaaataaaatgcccctggtaattgtggcgtgtgggtcgttttcg
ccaattacttatttacatttgagaatgtttgaaatggcacttgatgctattagagaacaa
actagatttgaagttattggtggttattattcaccagttagtgataattatcaaaaacca
ggattagcagccgcaagtcatagggttcgtatgtgtgagttagcttgtgaacgtacttca
tcttggttaatggttgatgcatgggaatcgttgcaaccaacgtatactagaactgcaaaa
gttttagatcattttaattatgaagttaacgttaagagaggaggtgtttcgacagtcaca
ggtgaaaaaatgggggttaaaattatgttattagctggtggtgatctgatagaatcaatg
ggagaaccaaatgtttgggcagatgccgatttacatcatattttaggtaattatggttgt
ctcatcttagaaagaacaggctctgatgttagatcatttttattatcgcatgatatcatg
tatcagcacagaagaaatgtgttagttatcaaacaattgatttacaacgatatctcctcc
actaaagtacgtcttttcataaggcgtaatatgtcagtacagtatttgttacccaactcc
gtcattagatacattcaggaacatggattgtacgttaatcaaactgaatccgttaaacaa
gttatgggtactaaggactaa

DBGET integrated database retrieval system