KEGG   Zymoseptoria tritici: MYCGRDRAFT_109241
Entry
MYCGRDRAFT_109241 CDS       T02285                                 

Gene name
ERG24
Definition
(RefSeq) ERG24, C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00100  Steroid biosynthesis
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MYCGRDRAFT_109241 (ERG24)
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MYCGRDRAFT_109241 (ERG24)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 13399970
NCBI-ProteinID: XP_003853302
JGI: Mycgr3_109241
UniProt: F9XA30
Position
4
AA seq 489 aa
MASKKVAVKAEPHGFEFGGPIGASLISFGLPIGCYAFAFLCNDVSGCPAPSLLSPSKLFT
APALSNKSGFQHALDTLATEVGWPGWTGLLNTEAVVGTLAWYAISLLLYAILPAQEVEGV
ELSTGGKLKYRFNTFLTAVTILVACAAGTFTLGPHFQVWTFIDRNYIQILTANILISYAL
GTYVYIASFGVKPGNADKRELAAGGHSGNILYDWYIGRELNPRISNPLVGEVDIKSFMEL
RPGMIGWMILDLAWIAKQYRTYGYITDSILMVVVSQSVYILDALWMEPAILTTMDITTDG
FGFMLAFGDLTWVPFIYSIPARYLSVHPIILGPAYIAAILAVQGLGYYIFRASNNEKNRF
RNNPNDPAVAHLKYIETASGSRLITSGWWGTARHINYMGDWFMSWSYCLPTLAAGYRLTP
SILYPGTRLVTTDGMQGYAMPITYFFMIYFAILLVHREMRDEAKCKRSFVRLQLPNYFTT
SIYLPSLFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcgtccaagaaggtcgcagtgaaagcagagcctcatggctttgaattcggcggaccc
atcggcgcctcactcatctccttcggcctgcccatcggctgctacgcctttgccttcctc
tgcaacgatgtttccggctgcccggcgccctccctgctctcgccgtcgaaactattcacc
gcgccggctctgtccaacaaatcaggattccagcacgccttggatacattggcaacagaa
gtgggatggccaggctggacgggtctgctgaatactgaggcggtcgtggggacattggcg
tggtatgcgatcagcttgttgctgtacgccattttgccggcgcaggaggttgagggtgtg
gagttgagtacgggagggaagttgaagtatcgtttcaacacgttcctcaccgccgtgacg
atcctcgtcgcatgtgctgccggtaccttcactctgggcccacacttccaggtctggact
ttcatcgaccgcaactacatccagatcctcacggccaatatcctcatctcctacgccctg
ggaacctacgtctacatcgcctccttcggcgtcaagcccggcaatgccgacaaacgggaa
ctcgccgccggcggccacagcggcaacatcctctacgactggtacatcggccgcgaactc
aacccccgcatctccaaccccctcgtcggcgaagtcgacatcaaatccttcatggagctc
cgcccgggcatgatcggctggatgatcctcgacctcgcctggatcgcaaagcaataccgc
acctacggctacatcacggattccatcctgatggtcgtcgtctcccagtccgtctatatc
ctcgacgccctgtggatggaacccgccatcctcaccacgatggacatcaccaccgacggc
ttcggcttcatgctcgctttcggcgacctcacctgggtgccgttcatctactccattccc
gcccgctacctcagcgtgcaccccatcatcctcggcccggcctacatcgccgccatcctc
gccgtgcaagggctcggatactacatcttccgcgcctccaacaacgaaaagaaccgtttc
cgcaataaccccaatgaccccgccgtggctcatctgaagtacattgaaaccgcgagtgga
tcccgcctcatcacctccggctggtggggcaccgcgaggcatatcaactacatgggcgac
tggttcatgagctggtcgtactgcttgcccaccctcgcggccggataccgtctcacgccg
agtattctgtacccgggcacgagactggtgacgacggatggcatgcaagggtatgcgatg
ccgattacgtatttcttcatgatctactttgcgattttgttggtgcatcgcgagatgagg
gatgaggcgaagtgtaagcgtagcttcgtacgactacaattacctaactacttcactact
tctatctacctgccttcactcttctcttaa

DBGET integrated database retrieval system