KEGG   Zymoseptoria tritici: MYCGRDRAFT_31712Help
Entry
MYCGRDRAFT_31712  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ztr  Zymoseptoria tritici
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MYCGRDRAFT_31712
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     MYCGRDRAFT_31712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 13395368
NCBI-ProteinID: XP_003857105
JGI: Mycgr3_31712
UniProt: F9X1B8
Position
1
AA seq 258 aa AA seqDB search
MVHNLAQCRVVIKRAIAGGAKALFLPEASDYIGGSPDETLSLCKPASSSPFLLGLQEEAK
KHSLPISVGVHEPSEDPNSKRIKNTLLWIDEKGQIAHRYQKVHLFDLEIEGGPIMKESNV
TEPGNKILPPFNSAVGKIGSMICFDLRFPEIALALKRQKADVLLYPSAFTVPTGKAHWLP
LLRARAIECESYVIAAAQVGAHTEKRTSYGHSIVIDPWGEVVAELGGEKKEEPEVIFAEI
DLELLKRVRTQMPLLRRT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtccacaatcttgcccagtgccgcgtggtgataaaaagggcaatcgccggtggggca
aaggcactcttcctccccgaagcaagtgactacatcggtggctcaccagacgagacattg
tcattgtgtaaacctgcgagctcttcgcctttccttctcggcttgcaagaagaggcaaag
aagcactcgttgccaatatctgtcggagttcatgagccgagtgaggacccaaacagcaag
cgaatcaagaacacccttctgtggatcgatgagaagggtcaaatcgcccaccgataccag
aaagtgcacctctttgacttggaaatcgagggaggtccgatcatgaaggagagcaacgtg
accgagccgggcaataagatcttaccgcctttcaactcggccgtggggaagatcggctct
atgatctgctttgatctgcgcttcccagagatagcgcttgctctcaaaaggcagaaggcc
gacgttcttctctatccttcggcattcaccgtaccaacgggcaaagctcactggcttcca
ctcctccgagcacgagcaatcgagtgcgagtcgtacgttattgctgctgctcaggtcggt
gcgcacaccgagaagcgaacaagctatgggcatagcatcgtcattgatccttggggagag
gttgttgctgagctcggtggtgaaaagaaggaagagccggaggtcatattcgcagaaatc
gaccttgagctattgaagcgagtcaggactcagatgcctctgttgaggcgaacgtaa

DBGET integrated database retrieval system