KEGG   Zymoseptoria tritici: MYCGRDRAFT_38524Help
Entry
MYCGRDRAFT_38524  CDS       T02285                                 

Gene name
MgSUC1
Definition
(RefSeq) putative beta-Fructufuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00052  Galactose metabolism
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCGRDRAFT_38524 (MgSUC1)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_38524 (MgSUC1)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MYCGRDRAFT_38524 (MgSUC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR DUF4975 PSII_BNR
Motif
Other DBs
NCBI-GeneID: 13404043
NCBI-ProteinID: XP_003854556
JGI: Mycgr3_38524
UniProt: F9X7Q0
Position
3
AA seq 591 aa AA seqDB search
MSKFSRWRPSYHLLAKDGWMNDPCAPGYDPDTGLYHVSFQWNPNGPDWGDISWGSATSPD
LISWTLAERPSLSPDMPYDNKGIFTGCFINGRDGSLTYAYTSVSDLPIHHTLPHVIGSES
LSLAKSFDHGKTWEKIAANPILPSEPIDIEVTGWRDPFVAPWPRMSRLLGLDSHNTLFGI
ISGGIRDATPTTFIYAIDANDLTKWDYIGPLTRFGLNYRPSRWSGDLGKNWEVSNFMTLK
DEEDPSVERDFIVMGTEGCLSDATAPSEAAVGPSRPARGQLWMSGSLQKSSDDQIPGPVD
MTYDYGGHLDHGCLYAANSFFDPRSDKHIVWGWLTEEDLCDELRHAQGWSGILSMPRELR
IQTMRHVIAASTSALSSITSIELEADAHGSHTVRTLASQPYQPLIEKLRQENGVRKSSLK
RTRLVNGDHSVHFSSAQVQSTAWELDCMFQVSRGTSKVGVSIAHTEDFSRSTTLTFDQSS
ETFIIDRPAFPVQNSSELINSASENAPHTLFASQDPASQEKSTEPLHIRVWRDSSALEVF
VNGRTAISTRIYAGDETFGMRFFGGLDEEIDGDGEVTELLSATIWDGIGVN
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattttccagatggcgaccctcctaccatttgttagcgaaggatggctggatg
aacgacccttgtgcgcctggctacgatcctgacactggcctttaccatgtctcgttccag
tggaatccaaacggaccagactggggcgacatctcttggggttcggcaacttcgcccgac
ctgatctcttggacgttggcagagaggccctcgctttcgccagatatgccctatgacaac
aagggtatcttcactggttgcttcatcaatgggcgggatggatcgctgacttatgcgtac
acctctgtcagcgatcttccaatccaccacacactcccacatgtcatcggcagtgagtcg
ttaagtctggcgaagtccttcgaccatggcaagacctgggaaaaaattgcagcgaatccg
atcctaccttcagagccgatcgatattgaggtgacgggctggcgagatcctttcgtcgct
ccgtggccgagaatgagccgactcttgggtcttgattcgcacaatacgcttttcggtatc
atctctggaggcatccgcgatgccaccccaacgacattcatctatgccattgatgcgaac
gatctgaccaagtgggactacatcggtcctttgacgagatttggtctcaattatcgtccc
tcaagatggagcggcgatcttggcaagaattgggaggtcagcaacttcatgaccctgaag
gacgaagaagacccttccgtggagagagacttcatcgtcatgggtacggaaggttgtctg
tcggatgcgacagctccttcagaagcggcagtgggtccgtcacgcccagctcgaggacag
ctctggatgtctggttccttgcagaagtcaagcgacgaccagattcccggtcccgtggat
atgacgtatgattatggcggccaccttgatcatggctgcttgtatgccgcaaactccttc
ttcgaccctcgatccgacaagcatatcgtttgggggtggctgacggaagaggacctgtgc
gacgagctgcggcatgcgcagggttggagcggaatcctctcgatgcctcgcgagctgcga
atccagacaatgcgccatgtcatcgccgcgtcgacatcggcgttgtcgtctatcacttcc
atcgagctggaggcagacgcacatggctctcacacggtccggacactggcaagccagccg
tatcagcccctgatagagaagcttcgacaagaaaatggcgtccgcaagtcgtcgttgaag
cgaacaagattggtgaatggtgatcacagcgtccatttctcgtccgcgcaagtgcagagt
accgcatgggagctagactgcatgttccaggtgtccagagggacgagcaaagtaggcgtg
agcatagcccacactgaagacttctcaagatccacgactctcacgtttgatcagtcgtcc
gagaccttcatcattgaccgaccagcgtttccagtgcagaactcatctgagctgatcaat
tctgcatcagaaaatgcaccgcacactctcttcgcttcgcaagatccagcatcccaggag
aagagcacggagcctttgcatatccgcgtatggcgggattcatccgccttggaggtattt
gtgaacggacgcaccgccatctcgactcgcatctacgccggcgatgagacttttggcatg
cgattctttggtggactcgatgaagagattgatggagatggtgaagtgacggagttgctc
agtgccacgatttgggacggaattggtgttaattag

DBGET integrated database retrieval system