KEGG   Zymoseptoria tritici: MYCGRDRAFT_38697Help
Entry
MYCGRDRAFT_38697  CDS       T02285                                 

Gene name
MgTpk1
Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr04113  Meiosis - yeast
ztr04138  Autophagy - yeast
Module
ztr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    MYCGRDRAFT_38697 (MgTpk1)
  Cell growth and death
   04113 Meiosis - yeast
    MYCGRDRAFT_38697 (MgTpk1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MYCGRDRAFT_38697 (MgTpk1)
Protein kinases [BR:ztr01001]
 Serine/threonine kinases: AGC group
  PKA family
   MYCGRDRAFT_38697 (MgTpk1)
Messenger RNA biogenesis [BR:ztr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MYCGRDRAFT_38697 (MgTpk1)
Chromosome and associated proteins [BR:ztr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    MYCGRDRAFT_38697 (MgTpk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 13404322
NCBI-ProteinID: XP_003854294
JGI: Mycgr3_38697
UniProt: F9X7Z0
Position
3
AA seq 382 aa AA seqDB search
MSQSSSAEKENTAAREEEKQKLSEWEAEKRPLEVEEIAVDPEKKPVGHSSKLLRKEDFEL
IKTLGTGTFARVWLVRLANQKNTSNNEYTKKVFALKILRKVDVIRLKQVEHVRNERNVLA
AVAGHPFITTMVASFQDADTLYMLLDYCPGGEVFSYLRRARRFNEATSQFYAAEIVLILE
FLHEKEGVAYRDLKPENILIDADGHLKLVDFGFAKKIAGRETYTLCGTPEYLAPEVIRNT
GHGLAVDWWAFGILIYEFLVGQPPFWDQNPMKIYEQIVEGKVRYPSAMSEDARDIIGGLC
TVDVSKRLGNVKGGAATVRSHPWFKNIDWDELYHRKMQGPIVPHLRSADDTRNFDDYDPE
PEKRDPYTKELQDKHERMFADF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcagtagtgccgagaaggaaaacacggccgcacgggaagaggagaagcag
aaactgtcagaatgggaagcagaaaagcggccgctggaggtggaagagattgccgtggat
cctgagaagaaacccgtcggacactcgagcaagctgttacgcaaggaggattttgagctg
atcaagactctgggaactggcacattcgcgcgagtctggttggtgagattggcgaatcag
aagaacacgagcaacaacgaatacacgaaaaaggtctttgcgttaaagattttgcgcaag
gtggatgtgatacgactgaagcaggtggagcatgtacgcaacgagcgcaatgttctggct
gctgttgcaggacaccccttcataacgaccatggtcgccagctttcaggatgcagacaca
ctgtatatgctgctggactactgcccggggggcgaggtcttttcctacctacgacgagcg
agacgattcaatgaggcaacgtcacaattctacgccgccgagattgtgttgatactggag
ttcttgcacgagaaggaaggcgttgcgtatcgtgacttgaagccggagaatatattgatc
gatgctgatggacacttgaaattggtggattttgggttcgcgaagaagatcgctggacga
gaaacatacacactctgcggcacacccgaatacctcgcgcccgaagtcattcgaaacaca
ggccacggcctcgcagtagattggtgggcctttggaatcctcatatacgaattcctggtc
ggacaaccgcctttctgggaccagaacccgatgaagatctacgagcagattgtcgaggga
aaagtgcggtacccaagtgcaatgtcggaggacgcacgcgatatcataggtggtctttgt
accgttgatgtttccaaaagacttggaaatgtcaagggaggtgctgctacagtgaggtca
catccttggttcaagaatatagattgggacgagttataccacaggaagatgcaagggccg
atcgtgccacatctacggtccgcggacgatacgcggaattttgacgactatgatccggag
cctgagaaacgggatccgtatacaaaggaactgcaagacaaacatgaacgcatgtttgca
gacttttaa

DBGET integrated database retrieval system