KEGG   Zymoseptoria tritici: MYCGRDRAFT_40465Help
Entry
MYCGRDRAFT_40465  CDS       T02285                                 

Gene name
PDC1
Definition
(RefSeq) pyruvate decarboxylase isoenzyme
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00010  Glycolysis / Gluconeogenesis
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCGRDRAFT_40465 (PDC1)
Enzymes [BR:ztr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     MYCGRDRAFT_40465 (PDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 13399267
NCBI-ProteinID: XP_003853362
JGI: Mycgr3_40465
UniProt: F9X945
Position
4
AA seq 576 aa AA seqDB search
MAEQTVPLGRYLWERIKQLGIKSVFGVPGDFNLTLLDHIYDVEGLEWVGNTNELNAAYAA
DGYARVKQGAGCVVTTHGVGELSALNAIAGAMTEQVKVIHVVGQTSLTMQKNKMMIHHSI
GSSPDHQVFNKASMGFRVAAAELQSEVDATKKIDETLRQCFVKSGPVYVFVPIDLVDKQV
PSKALETPIDLEPEFDPQVVEEATKAILDMVYASKHPSVFVDCLVQRHNAIKEATELVDK
LGVLVYTSNMGKGIIDETHPNYLGVYNGQISGPGVESAFEASDTVLVLGNLPSDTNSGGF
TRKIKTQAIYINEFDVSIQGGKTWTAPLKAVLASLVKTVQTDKVPKITKPKLPEAPLEED
HDSKSITQSWIWNYLADTYFRKHDVIFGETGTAAFGIPDTTFPAGINWITQTYYGSIGYC
TPAALGADVALSELASQSRPRGRTLLVTGDGSLMLTVQEVGNMVKLGLKPVILLINNSGY
TIERVIHGAHQSYNDIVPFDYKHMLPFFNMSPEQAAANFHRCTTKVGLEEILKKDSVRNP
QAVQVVEIVMDKLDVPWRLSMQIATRGEDAVQEMEG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaaacagtgccactcgggcgctacctgtgggagagaatcaagcaactcggt
atcaagagcgtcttcggcgtgcccggcgacttcaacctcaccctcctcgaccacatctac
gacgtcgaaggtctcgaatgggtcggcaacaccaacgaactcaacgccgcctacgccgcc
gatggctacgcccgcgtcaagcaaggcgcaggctgcgtcgtcaccacccacggcgtcggc
gaactgtctgcgctcaacgccatcgcgggagccatgactgaacaggtgaaggtcatccat
gtggttggacagacgtctctcaccatgcagaagaataagatgatgattcaccacagtatt
ggttcttcaccggatcatcaggtgttcaacaaggcttcgatgggatttcgagttgcggct
gcggagttgcagtcggaggttgatgccaccaagaagattgacgagacgttgaggcagtgc
ttcgtcaagtcgggtccggtgtatgtgtttgttccgatcgacttggtggataagcaggtt
ccttccaaagcactcgagacgcccatcgatctcgagccggagttcgatcctcaagtggtg
gaggaggctacaaaggccattctcgatatggtgtacgccagcaagcatccttccgtcttt
gtggactgtctcgtgcaacgccacaatgcgatcaaggaggctacggagctggttgataaa
ctcggtgtcttggtgtacacgagtaacatgggaaagggtatcatcgacgagacgcatccg
aattacttgggagtgtacaatggacagatctctggtccaggtgtcgagtcggcttttgag
gcgagcgacactgtgttggtgttggggaatctgccatcagacaccaactccggaggcttc
acccgcaagatcaagactcaagccatctacatcaatgaattcgacgtctcgatccaagga
ggcaagacatggaccgcgccactcaaagccgtcctcgcatccctcgtcaagaccgtgcaa
accgacaaagtccccaaaatcaccaagcccaaactccccgaagcacccctcgaagaagac
cacgactccaaatccatcacccaatcctggatctggaactacctggccgacacctacttc
cgcaaacacgacgtcatcttcggcgaaaccggcaccgccgcctttggcatccccgacacc
acctttcccgccggcatcaactggatcacacagacctactacggctcgatcgggtactgc
acacccgccgctctgggcgccgacgtcgccctgtccgaactcgcctcccaaagccgtcct
cggggccgcacactcctcgtcacgggcgatggaagcctcatgctcacggtccaggaagtc
ggcaacatggtcaaactcggcctgaaacccgtcatcctcctcatcaacaactccggctac
accatcgagcgggtgattcacggcgcgcaccagtcgtacaacgacatcgtgccgttcgac
tacaagcacatgcttcccttcttcaacatgtccccggaacaagcggcggccaacttccac
cgttgcaccaccaaagtcgggctggaggagattctgaagaaggactccgtgcgcaacccg
caggctgtacaagtcgtggagatcgtcatggacaagttggacgtgccgtggcgactgagc
atgcaaatcgccacgaggggcgaggatgcagtgcaggagatggaggggtaa

DBGET integrated database retrieval system