KEGG   Zymoseptoria tritici: MYCGRDRAFT_41016Help
Entry
MYCGRDRAFT_41016  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00052  Galactose metabolism
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCGRDRAFT_41016
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_41016
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MYCGRDRAFT_41016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 13397135
NCBI-ProteinID: XP_003853589
JGI: Mycgr3_41016
UniProt: F9X836
Position
4
AA seq 623 aa AA seqDB search
MLLQGISAFGIDYTAAPPNLTTLFNNTLFYTWRPKAHVLAPSAHIGDPCMQYTDPSTGLF
HAGYLYSGGAGESGAAAGTTGDLITYLDVNQDPTFIRRGGINDPVAVFDGSVIPAGINGS
ATLLYTSVAYLPIQWTIPYVKGSETQSLAVSSDGGRNFTKLEFGPVIPGPPFPLTNVTGF
RDPYVFQSPQLDRALSSQENTWYNIISGGVHGLGPSLFLFRQYDADFRDWEYLGELWHEQ
ANSSWGDGTWAGRWGYNFEVGNIFGLDEDGYNAEGEIFTTTGAEWSEEPIIPQVSQFREM
LWTAHTLDTSSNGSVSLVATMAGKLDWGAFAYAAAGKILPANSSASQASGVFHDRFITYL
WLTGDNFGTSDFPKAQQGWDGSLTTVRELSVGTISGVVNNDLVNETGSWRFSNSSDSTAS
TVELTTLKQTIAREVYAKIVSNAERTFVEPACNVVNGSGVEAFQQSPISKFFMLTTTIRF
PSSARTSGVKAGLRILGSEHEHTDIYYQFSNESMIVDRSNSSAAAATTPGILANNEAGRF
RLFDIATGAGNGSSIEALNLTIIVDNSIVEVYANGRFALSTWVWSWYEESTQISFFYEEA
DGVQYDNTTVYEGLFDAWPLRSY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgctactacaaggcatctctgcattcggaatcgactacactgccgctccgcccaacctg
accacgctcttcaacaacacgctgttctacacatggagaccgaaagctcatgtgttggcg
ccgtccgcccatataggtgatccgtgtatgcagtataccgatccatctactggcctgttt
catgcgggctacctctactccggaggcgctggagaatctggtgctgctgctggaaccacc
ggcgatctcatcacctatctggatgtcaatcaggatccaaccttcatccgaagaggaggc
atcaatgatcccgttgcggtatttgatgggtctgtcattcctgccggcatcaatggctcc
gcgactctgctatataccagcgtcgcatacctcccaatccaatggacgattccatatgtg
aaaggatccgaaacgcaaagtctggcagtgtcttcagatggaggcaggaattttaccaag
ttggagtttgggcctgtgattccgggtcctccatttccacttacaaacgtgacgggcttt
cgcgatccgtacgttttccagagtcctcaacttgaccgtgctctgtccagccaggaaaac
acatggtacaacatcatcagtggaggtgtgcacggtttgggaccttctctgttcctcttc
cgccagtatgatgcggacttccgtgattgggagtatctcggagagctgtggcatgagcag
gccaatagcagctggggtgatggaacctgggctggacgttggggatacaacttcgaagtt
ggcaatatcttcggactggacgaggatggctacaacgccgagggagagatcttcaccacg
acgggcgccgaatggtcggaggaacccatcattcctcaagtatcgcagttccgagaaatg
ctgtggactgctcatactctcgacacctcttcgaatggtagtgtgagtctggtagcgacg
atggcgggaaaacttgactggggtgcgtttgcctacgccgcggctgggaagattctgccg
gccaactcgagcgcatctcaggcttccggagtattccacgacaggttcatcacataccta
tggctgacaggcgataacttcgggaccagcgactttcccaaagcacagcaagggtgggac
ggttccttaacgaccgtacgtgagctttcggtcggcacgatcagcggtgttgtcaacaat
gatctggtcaacgagactggatcttggagattcagcaacagcagtgactcgacggcatcg
actgtcgagttgacgaccttgaagcagacgattgctcgagaagtgtatgctaagatcgtc
tctaacgccgaacgcacctttgtcgagccggcatgcaatgtggtgaatgggtccggcgtg
gaggcattccaacagagtccgattagcaagttcttcatgctgacgacgacaatccgcttt
ccatcctccgcaagaacatccggcgtcaaagctggcttgaggatactgggatcggagcat
gagcacaccgacatttactaccagttctctaatgagagcatgatcgtggaccggtccaat
tccagcgccgcggccgcgacgactcctggcatcttggcgaacaacgaggcgggacggttc
cgactgttcgacattgccactggagcaggcaatggcagctcaatcgaggcactaaacctg
acgatcatcgtcgacaacagtatcgtggaggtgtacgccaatggacgattcgcgttgagc
acgtgggtgtggtcttggtacgaggagagcacgcagatcagcttcttttatgaggaggca
gatggagtgcagtacgacaacactacggtgtatgagggtctgtttgatgcgtggccgctg
aggtcgtattga

DBGET integrated database retrieval system