KEGG   Zymoseptoria tritici: MYCGRDRAFT_45540Help
Entry
MYCGRDRAFT_45540  CDS       T02285                                 

Gene name
MgBGL6
Definition
(RefSeq) putative beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00460  Cyanoamino acid metabolism
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_45540 (MgBGL6)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    MYCGRDRAFT_45540 (MgBGL6)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     MYCGRDRAFT_45540 (MgBGL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-GeneID: 13397422
NCBI-ProteinID: XP_003850684
JGI: Mycgr3_45540
UniProt: F9XFN8
Position
7
AA seq 803 aa AA seqDB search
MIVLLPLLGLLALLPRRGKSHFTSPVVLPSRTFNTFPTIASSRRSLGSHSTAQGYGAGNW
SQAYDKARTMVGKMTLEEMNNLTVGQSTEHTGCVGLSGSAPRVGFPGMCLHDAGNGVRDT
DGVNAYASAVHIGASWNSTLAYQRARFMGAEFKRKGVNVALGPVVGPIGRIAQGGRNWEG
FGADAYLDGILGAQSVRGLQESVIASIKHWIANEQETNRNPIEDDDGTILSSSSNLDDRT
MHELYMWPFQDALYAGVGSVMCSYNRINGTYACENSKAMNSLLKGELNFQGFVVSDWVAQ
HSGIESANGGLDMAMPLSSYWDDDQLAKAVQGNELNETRLTDMATRIIATWYQFGQDDSD
FPATGVGMPPDLLQPHEYVDAKDPASKSSLLQQAVEGHVLVKNKANALPLGRLRIMSIFG
YDANIGLQQPQSQEIGSNEPLTNAPQTALGTLIVGGGSGSNSPAYISAPYDALQNRAYQD
DTSIYYDFHSSAPGVVAGSDACLVFINEYASEAWDRPGLADEESDELVKNVAAQCNNTIV
VIHNAGIRLVDAWIDNDNVTAVMFGHLPGQDSGRSVVQILYGEVSPSGRLPYTVAKSPSD
YGKLQGPCKDDSQSPQCDFDEGVNIDYRGFLARGVTPRFEFGYGLTYTTFEYSGLNIDMN
ATSTAGAPSTAPVYENDTTNQNVDRNDVGPGGLQSLFDKVGLVSAVVKNTGSVAAAEVAQ
LYIQIPVPKADQGNNANTRTLRGFQKVYIEPGESAKVNFSLRRKDISYWNTQNQTWTTPS
GEYEVYVGKSVLDLPLNGSFSLY
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgctactcccgctgcttggattgctggctttgcttccacgccgtggaaaatcg
cacttcaccagtccggtagtattgccttcacgtacgtttaacactttcccgacaattgca
agcagtaggagatcgcttggctcacactcaacagcgcaaggctatggcgccgggaactgg
tcacaggcatacgacaaagcccgtacgatggtcggtaagatgacgctcgaggagatgaac
aatctgactgttggtcaatccactgagcataccggctgcgttggcttgtctggatctgca
cctcgagttggctttcccggaatgtgccttcacgacgcaggaaatggtgtccgagatact
gatggagtcaatgcatatgcatcagccgtccacattggcgcatcttggaattcgaccctt
gcgtaccagcgtgctagattcatgggcgcagaattcaagcgcaaaggtgtgaatgttgcc
ctgggacctgtcgtcggaccaatcggtcggatcgctcaaggaggcaggaattgggaaggc
tttggtgcagatgcgtatctcgatggcatcttgggagcgcagtcagtacgaggcctccag
gaaagtgtcatcgcgagcatcaaacactggatcgccaacgaacaagagacgaatcgcaac
ccgatcgaggatgatgacggcacgattctcagctcgagctcgaacctggacgaccgtacc
atgcacgagctgtacatgtggccttttcaagatgcactgtacgcgggcgtcggctctgtc
atgtgttcgtacaaccgcatcaacgggacatatgcttgcgaaaacagcaaagccatgaac
agtctgctcaaaggagagctcaacttccaaggcttcgtggtgtccgattgggtggctcag
cattctgggatcgagtcagcgaatggcgggcttgatatggccatgcctctgtccagctac
tgggatgatgaccagcttgcaaaggctgtgcaaggcaacgagctgaatgaaacccgattg
acggacatggcaactcgtattatcgccacatggtaccaatttgggcaagacgattccgac
tttccggccactggagttggcatgccaccagatctccttcagccacatgaatacgtcgat
gcgaaggaccctgcgtcaaagagctcgctactccagcaggcggtcgaaggtcatgtgctg
gtgaagaataaagccaatgcgcttccgttgggcaggctgcgaatcatgtcaatctttggc
tacgatgcaaatatcggactacaacaaccgcagtcgcaggagatcggctcaaacgaacct
ttgacaaatgctcctcagacagcacttggaactctcatcgtcggcggtggatccggatcg
aactcgcctgcatacatcagtgcgccgtacgatgctcttcagaacagggcatatcaggat
gacacatcaatctactacgacttccactcctcagctccaggggtcgttgccggatctgat
gcttgcttggtattcatcaacgagtatgcctccgaggcgtgggatagaccgggtcttgct
gatgaagagtccgacgagctggtcaaaaatgttgcagctcagtgtaacaacaccatcgtg
gtcatacacaatgccgggatacgacttgtggatgcctggatcgataacgacaatgtcaca
gctgtgatgttcggtcatctccctggacaggatagcggacgttcggttgtacaaatactt
tacggcgaggtcagcccttccggacgactaccatataccgttgcaaaatcaccttccgat
tacgggaaattgcaaggtccttgcaaagacgactcccaatctccgcagtgcgactttgat
gaaggagtgaacatcgactatcgcggcttcctggctcgcggcgtgactccaagattcgaa
tttgggtacggcctgacgtataccacattcgagtactctggcttgaacatcgacatgaac
gcaacttcgacagctggagcaccgagcaccgcacccgtgtatgagaatgacaccaccaac
cagaacgtcgatagaaacgatgtcggtcctggtggtctgcagtctttgtttgacaaagtt
ggtctcgtcagcgccgttgtaaagaatactggatcagtcgccgcagcggaagtggcacag
ctgtacatccaaattcctgtgccaaaggctgatcaaggcaacaacgcaaacacacgtacc
ttgcgcggcttccaaaaagtctacatcgagccaggagaatccgcgaaagtcaacttcagc
cttcgtcgtaaggacatttcgtattggaacacgcagaaccaaacttggaccacgccttcg
ggagagtacgaggtatatgttgggaagagcgtcttggacttgccgctcaacggcagcttt
tcgctgtattga

DBGET integrated database retrieval system