KEGG   Zymoseptoria tritici: MYCGRDRAFT_50133Help
Entry
MYCGRDRAFT_50133  CDS       T02285                                 

Gene name
MgSUC2.2
Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00052  Galactose metabolism
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCGRDRAFT_50133 (MgSUC2.2)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_50133 (MgSUC2.2)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MYCGRDRAFT_50133 (MgSUC2.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 BNR
Motif
Other DBs
NCBI-GeneID: 13396181
NCBI-ProteinID: XP_003848549
JGI: Mycgr3_50133
UniProt: F9XM21
Position
11
AA seq 582 aa AA seqDB search
MNDPCGAVYDPTRDEYHLSYQWHPNHINWGNISWGSAMSKDLIHWEDHGGWENNEALILS
PSGNGTYNGLGIFSGTAQPVNTKGEVDGTLLIFYTSVSKLPTNWALPYQPGTETQSLALS
TDGGKTWEEYPGNPVITTTTEQAPMNWNITGFRDPFLEPSPELDALRGVDEPHYYAVFGS
GIKPEVGPRVPLWSAPANNLTDWTFLGALWEPAANTSVGPVLSTGSYGYNFEVSGFFALY
DSEGIAHWYVNVGSEGGNVSFHQSAQWALWNEGKVSRRDNGSVEFTPISGGAADWGSGYA
LTSFNDTKHNRRVQYAWVREDYVGDGGLFSTSQQGFQGALSLPRELFVHEVHHVDSSDEI
SYAKNSILEPKEDGSFTAHTMGVRPLPDVVAGLRRTAAKNTWNETTTYSSTTIVQEVGSA
HMEINAWISSASGPVGLVIEASPDGEEYTNIIYEPSNHTILVERMHSSNIVEFNNATITG
YFYPYSVNGTTEAINMNVFIDGSIAEIYINERFALSARIYPSKECSTGFGVYVGEGHTAE
VSSLEAWFGTDNVWPHRPLNCSSQLVFDTAEQTNNYTWWTGN
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccttgtggcgctgtttacgatcccacccgggacgaatatcatctgtcttac
caatggcatcctaatcatatcaactggggcaacatcagctggggctctgccatgagcaag
gacttgattcattgggaggatcatggcggctgggagaataatgaagctctcatcctgtct
ccctccggcaacggaacgtataatggattgggaatcttctccggcactgcgcagccggtg
aacaccaaaggagaggtggacggcactctgctcatcttttacacttcggtgtccaagctg
cccaccaactgggcgctgccataccagccaggtaccgagacccagagtctagcattgagc
actgatggcggcaagacgtgggaagaatatcccggcaatcctgtaatcaccaccacgacc
gaacaagcaccaatgaattggaacatcactggcttccgcgatcccttcctcgagccatcg
ccggagctcgacgcattgcgaggagtcgacgaaccacactactacgctgtattcggttct
ggcatcaaacctgaagtcggaccaagagtcccactctggtctgcacctgccaataatttg
accgattggacgttcctcggagctctttgggagccagcggccaacacttccgtcggtcca
gtcctctccaccggcagctatggttacaacttcgaagtcagcgggttcttcgcactttac
gacagcgaaggcatcgctcactggtatgtcaacgtcgggtccgaaggaggcaatgtgtcc
ttccatcagtctgcacaatgggcattgtggaacgagggcaaggtttctcgccgtgacaat
ggcagtgtcgagtttactccgatctctggtggcgctgcagattggggctccggctatgct
ttgaccagcttcaacgacaccaagcacaaccgccgagtgcagtacgcttgggtgagggaa
gactacgttggcgacggtggcctgttcagtacctcccagcaaggcttccagggcgctctc
tcgctgccgcgcgagctgttcgtccatgaggtacaccacgtcgactcgagcgacgagatc
tcttacgcaaagaactccattctcgagcccaaagaagacggctccttcacagcccacact
atgggagtacgtcctctccccgacgtcgtcgcaggtctccgccgcaccgctgccaagaac
acctggaacgaaaccactacctacagctccaccacgatcgtgcaggaagtcggatccgca
cacatggagatcaacgcctggatctcctccgcttccggacccgtcggtcttgttattgag
gcctcgcccgatggcgaggagtacacgaacatcatctacgagccttcaaaccacaccatt
ctcgttgaacgcatgcacagcagcaatatcgtcgagttcaacaacgccaccattactggc
tacttctacccttactccgtcaacggcacgacggaggcgatcaacatgaatgtcttcatc
gacggttctattgctgagatttacatcaatgaacgcttcgcgctgtcagcgaggatctac
ccgtccaaggagtgcagtaccggatttggtgtgtacgtcggtgagggccacaccgcggag
gtgagctcgctggaggcgtggttcggtacggataatgtctggccacaccgtccactgaac
tgcagctcgcagttggtgttcgatacggcggagcagaccaataactacacttggtggacg
ggtaactag

DBGET integrated database retrieval system