KEGG   Zymoseptoria tritici: MYCGRDRAFT_66273Help
Entry
MYCGRDRAFT_66273  CDS       T02285                                 

Definition
(RefSeq) phosphoinositide phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00562  Inositol phosphate metabolism
ztr01100  Metabolic pathways
ztr04070  Phosphatidylinositol signaling system
ztr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MYCGRDRAFT_66273
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MYCGRDRAFT_66273
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MYCGRDRAFT_66273
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MYCGRDRAFT_66273
Membrane trafficking [BR:ztr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    MYCGRDRAFT_66273
 Endocytosis
  Macropinocytosis
   Phospholipase C
    MYCGRDRAFT_66273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like
Motif
Other DBs
NCBI-GeneID: 13402896
NCBI-ProteinID: XP_003856342
JGI: Mycgr3_66273
UniProt: F9X135
Position
1
AA seq 1075 aa AA seqDB search
MSAGRSPGLIRRISRGAHNRLRRRASTNHSLRMRDQSAGPVLVRRRSDSNGASDFAQDVS
DLDLDSTAEDAGEDAAFPSSAHERTNALGINVGRPSIAPRTTSIFEGGIAPASSAVLENG
TWLTKITKRNTKRIKLWLDSSSARVCWHSSKPNKSFFVDDVREVRVGVESRNARDDVQIP
EDQEGRWVTIVYDVPERSKGRAIKTMHIIMPDDYILKLWTEALNIVTRERIEIMNALASS
PEKSEKSMTLAWSRVMARKSAGSAERFSLDDARWLCRKLEINCTDSAVKTHFKAVASDEA
AGLDHEQYRNFVRSFRERKDIQYIYRNIKFGTDLDMDLTTFLDFLKTEQAVDVVKERAHW
ESVFDKYSRPSQNKASLPDAEHIPGQRTLNMQSFQNFLTSSHCSPLIQRKGEPTTLDRPL
NEYFISSSHNTYLLGRQVAGASSVEGYIAALVKGCRCVEIDCWDGDDGRPMVTHGRTMTT
KIPFEDCVSVVAKYAFNSTPYPLIVSLEVHCSPEQQLAMVDLMKTYFHTMMVTEPIVPNS
STLPSPEELKNRILIKVKAAPEHVDQSQLIYEATNGRSRARSLTQSFNRTPSMENHSTVS
SPLVSSSVATSPSEYNAHSTPRGSITSGPTATPSSSADDSDDVPASADRMRKNNSNTSRI
HTELGKLGVYSQGIKFNGFSAPDARTFNHVYSFNENTFEKHFTKVGPNNKALLEKHNMKY
LMRVYPGARRIDSSNFNPLQSWRRGVQMAALNWQTYDVHQQVNEAMFAAGSDRLGYVLKP
EELRHAKHLPIADTVAEAPEKKEKKGKKLVKFSVDIISALRLPRPRNQTTETGGMNPYIE
FEMYSAEDKARGIATAEGGTDASARDGSSGIGSPLRKRTRIIEGNGFDPQYNQTITLAVE
TKYPSLIFVRWTVWNSPEGKNNSSNSVLLATFTAKFDSLQQGFRHLPLFNPQGEQYRDAK
LFVKIKKEAPISLSNEDNAYGIMDLPYANGTGSHGANSPRPTRPTENVSRTGGWPRRIFS
RSTSMQRKNENGSGAPSRTSSTQRAREGSEIGGPMTGYFSGELSRTSSMERELLK
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgggcggagtcccggtctgattcgaagaatctcccgcggcgcgcataacaga
cttcgacgcagagcgtcgaccaatcactccttgagaatgcgtgaccagagcgcaggaccc
gttctggtgcgccgccggagtgacagtaatggagcatccgatttcgcgcaggacgtgtcc
gatctggatctggacagtaccgccgaggatgctggcgaggatgcagcattcccatcttcg
gcgcacgaacggaccaatgctcttgggatcaatgttggccggcctagtattgcaccccgg
accacgagcatttttgaaggtggtatcgcacctgcgagctcggccgtgctggaaaacgga
acctggctcaccaaaatcaccaagcgtaatactaagcgtatcaagctctggctggactcc
agttcggctcgggtgtgctggcactcctcgaagcctaataagtcgttctttgtggatgac
gttcgagaggtacgtgttggtgttgaatccaggaatgctcgtgatgatgtacaaattccg
gaagaccaagaaggtcgctgggtcaccattgtgtatgatgtgccggagcgatcgaaaggt
cgagccatcaagaccatgcacatcatcatgccggacgactacatcttgaagctctggacc
gaagcattgaacattgttacgcgggaaagaatcgaaatcatgaatgcacttgcctcgtct
ccagaaaagagcgagaagagcatgactctggcttggagtcgagtcatggcacgaaaatct
gccggcagcgctgagcgcttctccttggacgatgcgagatggttgtgccgcaaactggag
atcaactgtaccgactccgccgtcaagactcatttcaaagccgtggccagtgacgaagct
gctggattggatcacgaacagtaccgcaactttgttcgttcattccgtgaacgcaaggac
attcaatacatctacaggaacatcaagtttggtaccgatctcgatatggacttgacgact
ttcctcgacttcttaaagaccgagcaggccgtcgatgttgtcaaggagcgggctcactgg
gagagtgtttttgacaagtactcgcgaccgtctcagaacaaggcgtcactccccgatgcc
gagcatattcccggacagcggacgctcaacatgcaaagcttccaaaacttcctcacctcc
tctcattgctcgcctttgatacaacgcaagggcgagcctactactctcgaccgaccgctc
aacgagtacttcatctccagctcacacaacacgtacctcctgggacgacaggtcgcaggc
gcctcgagtgtggagggttacattgccgctcttgtcaaaggatgccgatgtgtcgagatt
gactgctgggatggcgacgatggccgaccgatggtgacccacggcaggaccatgaccacc
aaaattccattcgaggactgcgtatcggttgttgccaagtacgccttcaacagtacaccg
tatccgcttattgtctccttggaagtccactgcagtccggagcaacaattggccatggtc
gacctgatgaagacttatttccacacgatgatggtcaccgagccgatcgtaccaaactct
tctactttgccttcgccagaagaactcaaaaacagaatcttgatcaaagtcaaggctgca
ccagaacacgttgaccagtcgcaactcatctatgaagccactaatggtcgcagccgagca
cggagcctcactcaatccttcaatcgcacgccgtccatggagaatcacagcaccgtttca
tcaccgctcgtatccagctcggtcgcgaccagtccctcggaatacaatgcacactcgaca
ccgcgcggctcgatcacctccggaccgaccgcaacgccgagcagctcggcagatgacagc
gacgatgttcccgcctcagcagacaggatgagaaagaacaattccaacacaagccggatc
cacaccgaattgggcaaactcggcgtctactcgcagggtatcaagttcaacggcttctct
gctcctgacgcccggacattcaaccacgtctactccttcaacgagaacacttttgagaag
catttcaccaaggtcggccctaacaacaaggccctgcttgaaaagcacaacatgaagtat
ctcatgcgtgtctaccctggcgcccgccggatcgactcttccaacttcaaccctctccaa
tcctggcggcgcggggtgcaaatggcggcactcaattggcaaacctatgatgttcatcag
caagtcaacgaggccatgttcgccgccggctctgaccgcctaggctacgtgctcaagccc
gaagagcttcgccacgccaagcacctccccatcgccgacaccgttgcggaggcacccgag
aaaaaggagaagaaaggcaagaaattggtcaagttcagcgtcgacatcatctccgctctt
cgactgccacgtcctcgaaaccaaactaccgagactggtggcatgaatccttatatcgag
ttcgagatgtactccgccgaggacaaggctcgcgggatcgccacagctgaaggcggcacc
gatgcctctgcccgcgatggctcctccggtattggctctcccttgcgcaaacggactcgc
atcatcgaaggcaacggtttcgacccgcagtacaaccagaccatcaccctagcagtggag
accaaatacccgtcgctcatattcgtgcgatggactgtgtggaactcgcctgagggcaag
aacaactcttccaactccgtcttgcttgccacctttactgcgaaattcgactcccttcag
caaggtttccgccacctaccgctcttcaatccgcaaggtgaacagtaccgcgacgcgaag
ttgtttgtcaaaatcaaaaaggaagctcccatctcgctctccaacgaagacaacgcgtat
ggcatcatggacttaccgtacgcgaacggtaccggcagccacggagccaattctccccgt
ccgacccgcccgacggagaacgtttcacgcactggaggctggccgaggagaattttcagc
cgtagcaccagtatgcagcggaagaacgagaacggaagtggagccccgagtcgcacgagt
agtactcagagagcgagagaaggtagcgagattggaggtcccatgacgggatatttctct
ggagaattgagtcggacgagtagtatggagagggagcttttgaaatga

DBGET integrated database retrieval system