KEGG   Zymoseptoria tritici: MYCGRDRAFT_66280Help
Entry
MYCGRDRAFT_66280  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00760  Nicotinate and nicotinamide metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MYCGRDRAFT_66280
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MYCGRDRAFT_66280
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     MYCGRDRAFT_66280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like LZ3wCH
Motif
Other DBs
NCBI-GeneID: 13402895
NCBI-ProteinID: XP_003856344
JGI: Mycgr3_66280
UniProt: F9X138
Position
1
AA seq 273 aa AA seqDB search
MAEINGEMTLDQYEFPNNRLRRRIMSEDRTPLVLIACGSFSPITFLHLRMFEMAADYARF
NTKFEVVGAYLSCVGDAYNKKGLVKAEHRINMCSLAVQQSSWIGVDPWEALHSEYLETAK
VLDHFDYEINTVMGGVETPNGKKKCRIALLAGADLIQTMSTPGVWAAKDIDYILRNFGAF
IVERSGTDIDEALAALQEWKDNIWVIQQLVQNDISSTKIRLFRRRDMSIRYLVPEQVVQY
IEEHSLYDEDGVASTSSSKERRAGESSGVSGNS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcaacggcgaaatgactcttgatcagtatgaattccccaacaatcgccta
cgccgacggataatgtccgaagaccgcactccccttgtccttatcgcttgcggctccttc
tcacccatcacttttctccacctgcgcatgttcgaaatggccgccgactacgcccgcttc
aacaccaaattcgaagtcgtaggagcatacctgtcatgtgtcggcgacgcatacaacaag
aagggactggtcaaggcggagcatcggatcaacatgtgctcactggcggtgcagcagagc
agctggatcggcgtggacccttgggaggctttacacagtgaatacttggagacggcaaag
gtgctggatcacttcgactacgagatcaacacagtcatgggaggagtcgagacaccgaat
ggaaagaagaagtgtcgtattgctctactggcaggtgccgatctcattcagaccatgagc
acgccgggtgtgtgggcggccaaggatatcgactacattctgcgaaatttcggcgcattt
atcgtggagagaagcggtacagacatcgatgaagccctagcggcactacaggaatggaag
gacaacatctgggtgattcaacaactcgtccaaaacgacatcagctcgaccaagatccgg
ctgttccgtaggcgcgacatgtcgattcgatatctggtcccagaacaggtcgtgcagtac
atcgaggagcacagtctgtacgacgaggacggcgtggcgagcaccagcagcagcaaggag
cgtcgagccggtgagagttcgggtgtgtcagggaactcatga

DBGET integrated database retrieval system