KEGG   Zymoseptoria tritici: MYCGRDRAFT_66750Help
Entry
MYCGRDRAFT_66750  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00260  Glycine, serine and threonine metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCGRDRAFT_66750
Enzymes [BR:ztr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MYCGRDRAFT_66750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 13395215
NCBI-ProteinID: XP_003857161
JGI: Mycgr3_66750
UniProt: F9WWT7
Position
1
AA seq 439 aa AA seqDB search
MLLRSRLLPWRGRSQLISAAAAMSFPFPAPRSPTSLRSLPRNNMSTALNTDKIESEAHHL
SNGSNGAHVPVNNWAAPGPTAFDFRSDTITTPTTRMLEAISATTLFDDVFQEDPTTNSLE
AFIADLTGKDSGLMVMSGTMGNQIAIRTHLGGPPHSVAADARSHIIEWEAGGVASLCGAM
LKPATPSNGKYVTLEDLKKVVDLREDVHGCPTKLISLENTIAGVVVPLEECQRISAWAKE
KGLIMHLDGARIWEAVAAGAASLKDYCACFDSISLCFSKGLGAPIGSIIVGTKAFTARSR
WVRKSIGGGIRQAGVITAAARVAVEDTFLGGKLQACHARAKQIGELWESYGGKTTNPVET
NMVWLDLEAAGVTADQFVEMGQKAGLRLLGGRLVVHYQISDEAVKRLDTLFQAVLKGKAL
DGDVSLDTERLKKSAPLYG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgcgatcgcgtctcctgccctggcgaggtaggagtcaactcatatctgccgcc
gcagcaatgtcgttcccattccccgctccacgctctcccacttctcttcgatcactacca
cgcaacaatatgtctacagcattgaacacggacaaaatcgagagcgaagctcaccacctg
tccaatggctccaatggtgctcacgtcccggtcaacaattgggctgctccaggaccaaca
gcattcgactttcgaagcgacaccataacgacacccaccacccgtatgctcgaagcaatc
tccgccaccaccctcttcgacgatgtcttccaagaagatccaaccaccaactccctcgaa
gccttcatagccgacctcacaggcaaagactccggcctgatggtcatgagcggcaccatg
ggcaaccagatcgccatccggacccacctcggcggtccaccgcacagtgtcgccgccgac
gcccgatcacacatcatcgagtgggaagcaggcggcgtggcgtcgttgtgtggagctatg
ttgaaacctgccacgccgagtaatggaaaatatgtcacactggaggatctgaaaaaagtg
gtggacctgcgggaggatgtgcatggatgtccgacgaagttgattagcttggagaatacc
attgcgggcgtggtggtgccactggaggagtgccagaggatctcggcgtgggcgaaggag
aagggtttgatcatgcacctggacggcgcgaggatatgggaggctgtcgcggctggtgcg
gcgtcgttgaaggactactgtgcttgctttgacagcatttcgctgtgcttctccaaggga
ctaggagcaccgattgggagcatcattgtcgggacgaaagcgttcaccgcaaggtcgaga
tgggtgaggaagtctattggaggtggcatcagacaagctggcgtgatcaccgctgcggcc
agagtggctgtggaagatacgttcctcggaggaaagctacaagcctgccatgcacgtgcg
aaacaaatcggcgagctgtgggagagctacggcggcaagacgacgaacccagtcgagacg
aacatggtgtggcttgacctcgaagcggcaggtgtgacggcggatcagttcgtcgagatg
ggtcaaaaggctggtctgcgattgctgggtggacgtctagttgtgcactaccagatcagc
gatgaagctgtgaagaggctggatacactcttccaggctgtgttgaagggcaaggcgttg
gatggcgatgtcagtctggacacagagagactcaaaaagtcggcgccgctgtacggctga

DBGET integrated database retrieval system