KEGG   Zymoseptoria tritici: MYCGRDRAFT_68282Help
Entry
MYCGRDRAFT_68282  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCGRDRAFT_68282
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MYCGRDRAFT_68282
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MYCGRDRAFT_68282
    1.1.1.-  
     MYCGRDRAFT_68282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NAD_binding_7 FAD_binding_3 ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 13403522
NCBI-ProteinID: XP_003855582
JGI: Mycgr3_68282
UniProt: F9X2A7
Position
2
AA seq 347 aa AA seqDB search
MKAARYYGATDIRIDHDAPEPIPGPRQLLVDVAWSGICGSDLHFWTIGPSPDRTLGLPST
LGHELCGTVRDPPVWSKFKHGDKVMVDPRICCRGCQACKDGTSAACSDLGYLGGTTEYGG
FGERVVVKESELYLLPENIPLEYAAIIEPLAVVQHAIKVSGVKEWKGRDVLVLGGGPIGF
ALLLVLKAAGADRVIVSEPAAVRREQVKSLSKGVINPIEESVEKKCLELTDGRGAEVVFD
CAGVPAGLESAFDAIRFNGLYVMIAVWEKPVSIPCMKFLAKHITMKGAYIFDDDSMGEVL
DMMATGKLTGYEKMVTSHIGIDDIVDKGFKELIANKDSHIKILVSPT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcccgctactacggcgcaaccgatatccgcattgaccacgatgctcctgaa
cccatcccgggcccgaggcaacttctagtcgacgtcgcctggagtggcatttgcggcagc
gatcttcacttttggaccattggtccttcacccgaccgcacgttggggctgccctccaca
ctcggccacgagctgtgcggcaccgtccgcgatccaccagtatggtcgaagttcaagcat
ggagataaggtgatggtcgacccgaggatttgctgtcgaggctgccaggcttgtaaagat
ggtacttcggcagcgtgttcggatctggggtatttgggtgggacgaccgaatatggaggg
ttcggagaaagggtggtggtcaaggagagtgagttgtacctcttacccgagaacattccg
ttggagtatgcagcgatcatcgagccgttggcggtagtacagcatgcgatcaaggtctcg
ggcgtgaaggagtggaaggggagggatgtgcttgtgctgggaggcgggccaattggcttt
gcgttgttgctggttttgaaagcggcgggagcggatcgggtgattgtctcggagccggcg
gcggtgaggagagagcaggtgaagagcttatcgaagggtgtgatcaacccgatcgaagag
agcgttgagaagaagtgtctggagttgactgacggccgaggcgcggaagttgtctttgat
tgcgcaggcgttccagctgggctggagtctgcttttgatgcgattcggttcaacggattg
tatgtgatgattgcagtctgggagaagccggtaagtataccgtgcatgaagttcttggcc
aagcatataacaatgaaaggcgcctacatctttgatgatgactcgatgggcgaagtcctg
gacatgatggccacaggaaaattgacagggtatgagaagatggtgaccagtcacattggg
atcgatgatattgttgataaggggttcaaggagctgattgccaacaaggacagccacatc
aagatcctcgtgagcccaacatag

DBGET integrated database retrieval system