KEGG   Zymoseptoria tritici: MYCGRDRAFT_68779Help
Entry
MYCGRDRAFT_68779  CDS       T02285                                 

Gene name
MgGlgB1
Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_68779 (MgGlgB1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MYCGRDRAFT_68779 (MgGlgB1)
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCGRDRAFT_68779 (MgGlgB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 13400951
NCBI-ProteinID: XP_003855404
JGI: Mycgr3_68779
UniProt: F9X4J8
Position
2
AA seq 711 aa AA seqDB search
MDKLNEASADSVMQKPANGQAANDGTGVVQLDPWLEPYTAALKSRFAKAQDWIKKIDKAE
GGLEKFSRGYEKYGFTVADDHTITYREWAPFALRAFLIGDFNGWDRDSHEMQRDAFGVWE
IKLPAVNGQPAIPHDSKIKISMVVPNDHARAERIPAWIKRVTQDLNVSPVYDARFWNPPQ
AYQFKNARPPKPLSARVYEAHVGISSPDPKVATYKEFTQNTLPRIRDLGYNTIQLMAIME
HAYYASFGYQINSFFAASSRYGHPDDLKELIDTAHGMGITVLLDVVHSHASKNVLDGLNK
FDGSDHLYFHEGARGQHELWDSRLFNYGHHEVLRFLLSNLRFWMDEYRFDGFRFDGVTSM
LYTHHGIGTGFSGGYHEYFGPNVDEDGVVYLMLANEMLHTLYPDCITIAEDVSGMPALCI
KLSLGGIGFDYRLAMAVPDLYIKWLKEKQDIDWDMGALCFTLTNRRHGEKTIAYAESHDQ
ALVGDKTLLFWLCDAQMYTNMSKLSEFTPVIERGMALHKMIRLITHALGGEAYLNFEGNE
FGHPEWLDFPREGNNNSFHYARRQFNLVEDNLLRYHYLNDFDKAMQWTENKYGWLHSPQA
YISLKNESDKVIVFERAGLLWIFNFHPSSSFTDYRVGVEHAGTYRVVLNTDDENFGGLAR
IANDTRHFTTDFEWNGRKNFLQVYLPTRTAMVLALEETLDPNWKSHVSLGF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgaacgaggcctccgccgacagcgtcatgcagaaaccggccaacggtcag
gccgctaatgacggcactggtgttgtccagctcgatccatggctcgaaccatataccgcc
gccctcaaatcccgattcgccaaagcacaggactggatcaagaagattgacaaggccgaa
ggcggtctggagaagttctctcgcggctacgaaaagtacggcttcaccgtcgccgacgac
cacaccatcacctaccgcgaatgggcaccctttgcgctccgagcatttctcattggagac
ttcaacggatgggacagagacagtcatgagatgcaaagagatgcgttcggcgtgtgggag
atcaaattgcccgcagtcaatggccaacccgccatcccacacgacagcaagatcaagatc
agcatggtggtgccgaatgaccacgcacgagcagagaggataccagcgtggatcaagcgt
gtgactcaggacttgaacgtctcaccagtctacgatgcccgcttctggaacccaccgcaa
gcataccagttcaagaacgcacgtccaccgaagccgctcagcgcgagggtgtacgaggca
cacgtgggtatctcgagcccggatcccaaggttgctacctacaaagagttcacacaaaac
actctgccacgcattcgcgatctcggatacaacaccatccagctcatggccatcatggag
cacgcgtactacgcttcgtttggctaccagatcaactccttcttcgcagcttcatcgcgt
tacggtcacccagatgacctcaaagagttgattgacaccgctcacggaatgggtattacc
gtgctcctcgatgtggtgcattcccacgccagcaagaacgtgctcgacggtctgaacaag
ttcgacggcagcgatcacctctacttccatgagggtgcccgcggacagcacgagctttgg
gacagcagactcttcaactacggccatcatgaggtcctccgcttccttctctccaacttg
cgattttggatggacgagtaccgctttgatggcttccgattcgatggtgtgacgagcatg
ctctacactcaccacggcattggcacaggtttcagcggcggctaccacgagtacttcggg
ccaaacgttgacgaggacggtgtcgtgtacctcatgcttgcgaacgagatgctgcacacg
ctctacccggattgtatcacaattgcggaagacgtgagcggaatgccggcattgtgcatc
aagctgagtctgggcggaataggattcgactacagactcgccatggcagtaccagatctc
tacatcaagtggctgaaggagaagcaggacatcgactgggatatgggcgctctgtgcttc
actttgaccaaccgcagacatggcgagaagaccattgcttacgccgagtctcacgaccaa
gctctcgtcggcgacaagaccctcctcttctggctctgcgacgcacaaatgtacaccaac
atgtcaaagctatctgagttcacacctgtcatcgagcgtggcatggctctccacaagatg
atccgcctcatcacacacgctctcggcggtgaagcgtacctcaacttcgagggcaacgag
tttggacatcccgaatggctcgacttccctcgcgaaggcaacaacaacagctttcactac
gctcgtcgccagttcaatctcgtcgaggacaacctcctgcgataccactacctcaacgac
ttcgacaaggcaatgcagtggaccgagaacaagtacggctggctgcactctcctcaagcg
tacatcagcttgaagaacgagagtgacaaggtcatcgtgtttgagcgcgcgggtctgtta
tggatcttcaacttccacccgtcgagctcgttcacggactaccgtgtcggtgtcgagcac
gcaggcacatatcgcgtggtgctaaacacggatgacgagaacttcggcggcctggcgcga
atcgcaaacgacacgaggcacttcacgacggactttgagtggaacgggcggaagaacttt
ctgcaagtttacttgccgacgaggacagcaatggtcctggctctggaagagactctggat
cccaactggaagtcgcacgtgtcccttggtttctag

DBGET integrated database retrieval system