KEGG   Zymoseptoria tritici: MYCGRDRAFT_69942Help
Entry
MYCGRDRAFT_69942  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCGRDRAFT_69942
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MYCGRDRAFT_69942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 13395571
NCBI-ProteinID: XP_003854385
JGI: Mycgr3_69942
UniProt: F9X691
Position
3
AA seq 313 aa AA seqDB search
MPEALDYKTFVVPLVIVVVAILGGFFFLTGEESPKDRPQPPAPEKAQQESRGPNTAIDPK
TFTEFPISEKTQTSHNTAIYRFKLPTEDSILGLPIGQHISLAADLDVTDPKTGEVQNKEV
VRSYTPISSDVTPGHFDLLIKSYPTGNISRHLATLNVGDKMKVRGPKGAMVYTPNMVRRF
GMIAGGTGITPMLQVCQAIRRGRKDGDKTEVDLIFANVNEEDILLREDLDALAKEDGFNV
YYVLNNPPSGWTGGVGFVTADMIKERLPAPAKDVKILICGPPPMVSAIKKATESLGFDKA
RPVSKLEDQVFAF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagccttggactacaagacctttgtcgttcctctcgtcatcgtagtcgtcgcc
atcctcggtggcttcttcttcttgaccggcgaagagtcgccgaaagatcgccctcagccg
cctgctcccgagaaggcacagcaagaatctcgcggaccgaacactgccatcgacccaaag
accttcaccgaatttccaatctccgagaagacccaaacatcgcacaacaccgccatctac
cgcttcaagcttcccacagaggacagcatcctcggccttccaatcggccagcacatctcc
ctcgccgcggacctcgacgtcaccgacccaaagaccggcgaagtgcagaacaaggaagtc
gtacgatcatacacgccgatctcttcagatgtcacgcccggccactttgacctgctgatc
aagagctatccgaccggtaacatctcccgccatctcgcgactctcaatgtcggtgataag
atgaaggtgcgtgggccaaagggcgccatggtatacactcccaacatggttcgtcgcttt
ggaatgatcgcaggtggtaccggtatcacaccaatgcttcaggtctgtcaggcgattcgc
cgtggtcgcaaggacggtgacaagacagaggttgaccttattttcgccaacgtcaatgag
gaggacatcttgctcagggaggatctcgatgctttggctaaggaggatggcttcaacgtc
tactatgttctgaacaaccctccatctggatggaccggtggtgtcggctttgtgaccgca
gacatgatcaaggaacgtctccctgcacctgcaaaggacgtcaagatcctcatctgtggt
cctcctcctatggtttctgcgatcaagaaggccaccgagtcattgggcttcgacaaggct
cgaccagtcagcaagctcgaggatcaagtcttcgccttctaa

DBGET integrated database retrieval system