KEGG   Zymoseptoria tritici: MYCGRDRAFT_72515Help
Entry
MYCGRDRAFT_72515  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00330  Arginine and proline metabolism
ztr00332  Carbapenem biosynthesis
ztr01100  Metabolic pathways
ztr01130  Biosynthesis of antibiotics
ztr01230  Biosynthesis of amino acids
Module
ztr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYCGRDRAFT_72515
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MYCGRDRAFT_72515
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MYCGRDRAFT_72515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 13396814
NCBI-ProteinID: XP_003852325
JGI: Mycgr3_72515
UniProt: F9XC30
Position
5
AA seq 524 aa AA seqDB search
MDDHGETSSATTPNPTAPPTPFRLEKAEDRGHNRVPVRMKKHLTIVIKLGTSSIVDEKTH
EPLLSILSTIVETAVSLRHDGHRVVICSSGAIGMALRQMNLPRRPKHLPQVQALAAIGQC
KLMSMWDQLFQHMRQPVAQILLTRNDIADRTQYLNAQNTFVELLNMGVIPIVNENDTLSV
QEIKFGDNDTLSAITAGMVQADYLFLMTDVDCLYDKNPRTHPDALPIEVVSDIADLAADT
SSAGSSLGTGGMSTKIVAARLATAAGVTTVITRSSQPGNISAIVRYVEAQKSTACLANSD
ELPPRAIDPHLQKFAIEHPVNGDHHPPQILPPDLEPPPLHTRFLPDLFPIRDRYFWLLHG
LAPHGTVYIDSGAHTALCSKAGLLPVGVVAVEGSFHQHECVSLKVLPSRDSKLEDGEEVG
KAIVNYSSGEIGRIKGRRSKEIEERLGYADSEYVAWRDCVALYARLGSRPGSPLNGHGSV
NGSRNGAGSANGDAADDGEGIRAELGRRSSERRRMGSLSGFVER
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccatggcgagacctcgtctgctacgactcccaatcctacagcacctcccacg
ccgttccgcttggagaaagctgaggatcgaggacataatcgcgtgccggtcaggatgaag
aagcatttgacgattgtcatcaagctgggcacctcctccatcgtcgacgaaaagacccac
gaacccctcctctccatcctctccaccatcgtcgaaaccgccgtctccctccgccacgat
ggtcaccgcgtcgtcatctgctcctcgggagccatcggcatggccctccgccagatgaac
ctcccccgccgcccaaaacacctcccacaagtccaagccctcgcagcaataggacaatgc
aagctcatgtccatgtgggaccagctcttccaacacatgcgtcaacccgtggcacaaatc
ctgctcacgagaaacgacatcgccgatcgcacgcagtacctcaatgcgcagaatacgttt
gtggaattgttgaatatgggtgtgataccgattgtgaatgagaatgatacactttctgtg
caggagattaagtttggggataatgatacgctgtctgctattacggcggggatggtgcag
gctgattacctctttctcatgacggacgtcgactgcctctatgacaagaatccgaggacg
caccctgatgcactcccaattgaagtggtctccgacattgccgaccttgccgctgatacc
tcctccgctggctcctccctcggcacaggcggcatgtccaccaaaatcgtcgccgcgcgc
ctagccaccgcagcaggcgtgacaaccgtcatcacccgctcctctcaaccgggaaatatc
tccgccatcgtgcggtacgtggaagcacaaaaatccaccgcctgcctcgcaaattcagac
gaactcccaccacgagcaatcgatccgcatctgcagaagttcgcaatcgaacatcccgtc
aacggcgatcatcatcctcctcaaatcctcccgccagatctcgagcctcctccactacac
acccgattcttaccggacttattccccatccgtgaccgctacttctggctcttgcacggt
ctcgcgccgcatggaacggtatacatcgactccggagcccacaccgctctctgttccaaa
gccggcctcctccccgtcggcgtcgtcgcggtagaaggttccttccaccaacacgaatgc
gtctcgctcaaagtcctaccatccagggattcaaaactcgaagatggcgaggaagtgggt
aaagcgatcgtcaactacagttcaggggagatcggaaggatcaagggtaggaggagtaag
gagattgaggagaggttggggtacgcggatagtgagtatgtggcttggagggattgcgtg
gcgttgtatgcaaggttggggtcgaggccgggaagtccgctgaatgggcatgggagtgta
aacgggagtagaaatggtgccgggagtgcgaatggggacgcggcggatgatggggagggg
attagagcggagttgggcaggagatcgagtgagaggaggaggatggggagtttaagtggg
tttgtagagcggtga

DBGET integrated database retrieval system