KEGG   Zymoseptoria tritici: MYCGRDRAFT_74730Help
Entry
MYCGRDRAFT_74730  CDS       T02285                                 

Gene name
LSC1
Definition
(RefSeq) succinate--CoA ligase (GDP-forming) subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00020  Citrate cycle (TCA cycle)
ztr00640  Propanoate metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01200  Carbon metabolism
Module
ztr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ztr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCGRDRAFT_74730 (LSC1)
   00640 Propanoate metabolism
    MYCGRDRAFT_74730 (LSC1)
Enzymes [BR:ztr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MYCGRDRAFT_74730 (LSC1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MYCGRDRAFT_74730 (LSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 13394896
NCBI-ProteinID: XP_003850028
JGI: Mycgr3_74730
UniProt: F9XHM3
Position
8
AA seq 348 aa AA seqDB search
MQSVRQGLTRAVRNAPQGITRSVAAPYATVAPSDAPGAPTGYAATGMNLRITKDTKVLFQ
GFTGKQGTFHATGAIEYGTNVVGGTNPKKAGSEHLGKPVFANVEEARKATGADASAIFVP
PPLAAAGIEEALKAEMPLVVCITEGIPQHDMVRITDMLKTQNKTRLVGPNCPGIIAPGQC
KIGIMPGFIHKRGRIGIVSRSGTLTYEAVNQTTQAGLGQSLVIGIGGDPFSGTNFIDCLR
VFLSDKDTDGIIMIGEIGGSAEEEAADFLKQYNNGGKDGKGKPVVSFIAGISAPPGRRMG
HAGAIVSGGKGDANSKIKALEGAGVIVERSPASLGKTLRDQFIQRDLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccgtccgccaggggctcacgcgcgccgtgcgcaatgctcctcagggcatcacc
cgctccgtggcagctccgtatgccaccgtcgctccctccgatgcgccaggcgcgcccact
ggctacgcagcaacgggcatgaacctccggataacgaaggacacaaaggtgctatttcaa
ggcttcaccggcaagcagggcacgttccatgccactggagccattgaatacggtaccaac
gtcgttggaggcacgaatccaaaaaaggccggcagcgaacatctgggcaagccagttttt
gccaatgtggaggaggccaggaaagctactggcgccgatgcatccgccatcttcgtccca
ccgccgcttgctgccgctggtattgaggaggctttgaaggcagagatgcctctcgttgtc
tgcattacggagggaatcccacaacacgacatggttcgcattaccgatatgctcaagaca
cagaacaagacaagactggtcgggcccaactgccccggaattatcgctcctggtcaatgc
aaaatcggaatcatgccaggctttatccacaagcgcggccgcatcggcatcgtctcccgc
tccggtaccctcacctacgaagctgtcaaccagaccacacaagccgggctgggccagtcg
ctcgtcatcggaatcggcggtgatcccttctccggcaccaacttcatcgactgcctacgc
gtcttcctctcggacaaggacaccgacggcatcatcatgattggagagattggtggttca
gctgaagaggaggccgcggacttcctgaagcagtacaacaacggcggcaaggatggcaag
ggcaagccagtggtcagcttcatcgcgggtatctctgcgccgccaggccgaagaatgggt
cacgctggtgccattgtgtctggtggtaagggtgatgccaacagcaagatcaaggctctt
gagggcgcaggcgtcattgtcgagaggagcccggcaagcttgggcaagactttgagggat
cagttcattcagcgggatttgctatga

DBGET integrated database retrieval system