KEGG   Zymoseptoria tritici: MYCGRDRAFT_76215
Entry
MYCGRDRAFT_76215  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00910  Nitrogen metabolism
ztr01100  Metabolic pathways
Module
ztr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ztr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MYCGRDRAFT_76215
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     MYCGRDRAFT_76215
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C Pyr_redox_3
Other DBs
NCBI-GeneID: 13398631
NCBI-ProteinID: XP_003848835
JGI: Mycgr3_76215
UniProt: F9XLN7
Position
10
AA seq 1092 aa
MAPPMNAGMDASEMPQHSDRKRVVVVGLGMVGVAFIEKLLKLDVKRREYDVVVIGEEAHL
AYNRVGLTSYFQHRQVENLYLNPASWYASMPTGSLSYHLNTLVTEIDTEHKTVATSQGDT
VPYDILVLATGSDAVLPRHTPGHDANGVFVYRTIEDLQKLIDFADTRKGTVGAVVGGGLL
GLEAAKAMMDLEKFDKVTLVERNRWVLSRQLDDDAGSMVVEQVRHLGLDVLLSKRVGKVN
TDDDNNVVGVTFEDGESMDCSTICFAIGIKARDDLARKSGIACADRGGGIIVNPDLSTSA
PDVYAIGECASWESQTFGLIAPGIEMADVLAFNLTQAKAHTPRKFKRPDLSTKLKLLGVD
VASFGDFFADRDGLKDAPRKRRGVRSDAPSDESAPGVKALTYRDPFQQIYKKYLFTPDGK
YIIGGMMIGETKDYVKLVSMVNNQKPLEVPPSEFIVGKSSGEDDADDLDDDTQICSCHNV
SKGDVCNGVKDGSCKSIGDVKSCTKAGTGCGGCMPLVQSIFNKTMASMGQEVKNHLCPHF
EYSRADIFHIVYVKKLQDFPSIMKECGKDPTAAGCEACKPTIGSILASLYNKHVMDDNIR
GLQDTNDRFLANIQRNGTFSVVPRVSGGEITADKLIVMGTVAKKYGLYCKITGGQRVDMF
GARKQDLPAIWTELIDGGMESGHAYGKSLRTVKSCVGTTWCRFGVGDSVGMAVRLEERYK
SIRSPHKMKGGVSGCVRECAEAQSKDFGLIATDKGWNIFVGGNGGAKPRHCDLLAKDVPP
DDVVTIVDRYLMFYMRTADKLQRTARWVESLPGGIKYLKEVILEDKLGICAELEKQMEEL
VGTFFDEWKEVLESPKRLELFPQFGNTADTVDSIEKVQEREQERPAYWPKESVTEDFRGK
QWSTLSWQPLAKSSQFSDSMTGSSLAVKRGDTQLAIFKVKGRYYCTQQMCPHKRAFVLSD
GLIGEDVQNNKLWVSCPLHKRNYAMKGEEAGKCSNDETVNIATFPVESREDGHVYVKLPP
VEELDEVLGTEKWKVKKEETETKGDFEALDKKFKMKGRKPFAASHLANGLGEHAKANAIL
AGGERGSNGMDW
NT seq 3279 nt   +upstreamnt  +downstreamnt
atggcccctcccatgaatgccggaatggacgccagcgagatgcctcaacactcagaccgc
aaacgggtggttgtggttggcttgggaatggttggcgttgcgtttattgagaagcttctc
aaattagacgtcaagcgaagagagtatgatgtggtggtgataggtgaggaggcacatctg
gcatacaaccgtgtcgggcttaccagctactttcaacatcgtcaagttgagaatctctac
ctcaatccggcatcatggtatgcctccatgccaactggatcgctttcataccatctcaac
acacttgtcaccgagattgacaccgagcacaagaccgtggcaacatcacaaggcgacaca
gtcccgtatgatatcctcgtcctcgcaaccggttccgatgctgtgctacctcgacatacg
cccggccacgatgcaaacggagtcttcgtataccgaacgatcgaggatcttcagaagctc
atcgacttcgcagacacgaggaaaggcacagttggagcagtggttggtggtggtctactc
ggactggaggcggcaaaagcaatgatggatctggagaagttcgacaaagtcacactcgtg
gagcgcaacagatgggtactcagcagacaacttgacgacgatgcaggtagcatggtagtt
gaacaggtgcgacacctcggactcgatgttcttctcagcaagcgagttggcaaggtcaac
acagacgatgacaacaatgtcgtcggtgttacgtttgaagatggtgagagcatggactgc
tcaacgatatgcttcgcgatcggcattaaggcgagagacgatctggcgaggaaatccgga
atcgcgtgcgccgaccgtggtggtggtatcattgtcaaccctgacctctcgacttcagct
cccgatgtctatgctatcggagagtgcgccagctgggaaagccagacatttggtctcatc
gctccaggaatcgagatggccgacgtgctcgcctttaatctcacacaagcaaaagctcac
acaccacggaagttcaagcgaccagatctcagcacaaagttgaagctccttggtgtggat
gtcgcaagttttggcgacttcttcgcagaccgcgacggactgaaagatgctcctaggaag
cgacgaggtgttcgatcagacgctccgtcggacgagtcagcgccgggcgtcaaggctttg
acataccgggatcctttccagcagatatataaaaagtacctcttcactccggacggcaag
tacatcattggcggcatgatgattggcgagaccaaagactacgtcaagcttgtctctatg
gtcaacaatcagaaacctcttgaggtaccgccatcggagttcatcgtcggtaaatcctca
ggggaggacgatgcggacgacctcgacgatgatactcaaatctgctcgtgtcataacgta
tccaagggcgacgtatgcaacggcgtcaaagacggatcatgcaaatcgatcggggacgtc
aagtcctgcacaaaagccggcactggatgtggaggctgtatgcctttggtccagtccatt
ttcaacaagacgatggcctcgatgggccaggaagtcaagaatcacctctgcccgcacttc
gagtattcccgagccgatatcttccacatcgtctacgttaagaaactacaagactttcca
tcgatcatgaaggagtgtggcaaggatccgaccgccgcgggctgcgaagcgtgtaagccg
actattggctctatcctcgcctccctttacaacaaacatgtcatggacgacaacatccgt
gggctacaagacaccaacgatcgcttccttgcgaacatccaacgtaacggaacgttttcg
gttgtacctcgtgtttcgggcggagagattacagctgacaagctgatcgtcatgggtact
gttgccaagaaatatggtttgtactgcaagatcaccggcggtcaacgagtggatatgttc
ggagctcgcaagcaagacttgcctgctatttggactgagctcatcgatggcggtatggag
tccggtcatgcctacggtaagagtttacgcacagtcaagtcatgtgtcggaaccacctgg
tgccgtttcggcgtgggtgactcagtgggcatggccgtgcgccttgaggaacgctacaag
agcatccgctcgccccacaagatgaaaggcggtgtatccgggtgtgtgcgtgagtgtgcc
gaagcacagagcaaagactttggcctgattgccaccgacaaaggctggaacatcttcgtg
ggcggcaacggtggcgcaaaacctcgacactgcgatctactggccaaagatgttcctccg
gatgatgtcgtcactatagtcgaccgatatctcatgttctacatgcgcacagccgacaag
cttcaacgaacagctcgttgggtcgaaagtctccccggcggcatcaagtacctgaaagag
gtcatcctagaagacaagctcggcatctgcgcggagctagaaaagcaaatggaagagctc
gtgggaaccttcttcgacgagtggaaagaagtcctcgaaagtcccaaacgccttgaactc
ttcccgcaattcggcaacaccgcagacaccgtcgactccatcgaaaaagtccaagagcgc
gaacaggaacgtccagcatactggccgaaagagtccgtgactgaggacttccgcggcaag
caatggagcaccctctcctggcaaccactagccaaatcctcgcagttcagcgactcgatg
accggttctagtttggcggtcaagcgaggcgacacccagttggcgattttcaaggtcaag
gggaggtactactgcacacagcagatgtgtccgcacaagcgggcgtttgttctcagtgat
gggcttattggcgaagacgttcagaacaacaagctttgggtcagctgtccgctgcataag
cggaactatgccatgaaaggcgaagaggcaggtaagtgcagtaacgacgaaacggtcaac
atcgccacgtttccagtggagtcacgggaggatggccatgtgtacgtcaagctgccgccg
gtggaggagctggatgaggttttgggcacggagaagtggaaggtgaagaaggaagagacg
gagacgaagggagactttgaggcattggacaagaagttcaagatgaagggacgaaagccc
tttgctgcgagtcacttggcaaatgggttgggagagcatgccaaggcgaacgcgattttg
gcgggtggggagagaggaagtaacgggatggattggtag

DBGET integrated database retrieval system