KEGG   Zymoseptoria tritici: MYCGRDRAFT_77226Help
Entry
MYCGRDRAFT_77226  CDS       T02285                                 

Definition
(RefSeq) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00450  Selenocompound metabolism
ztr00970  Aminoacyl-tRNA biosynthesis
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MYCGRDRAFT_77226
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MYCGRDRAFT_77226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ztr01007]
    MYCGRDRAFT_77226
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ztr03016]
    MYCGRDRAFT_77226
Enzymes [BR:ztr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MYCGRDRAFT_77226
Amino acid related enzymes [BR:ztr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MYCGRDRAFT_77226
Transfer RNA biogenesis [BR:ztr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MYCGRDRAFT_77226
 Prokaryotic type
   Other AARSs
    MYCGRDRAFT_77226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 13401510
NCBI-ProteinID: XP_003848219
JGI: Mycgr3_77226
UniProt: F9XPI3
Position
12
AA seq 652 aa AA seqDB search
MNGAKKEVILPVEGKKNVLITSALPYVNNVPHLGNVIGSVLSADVFSRYSKARGLPTLFI
CGTDEYGTATETKAIEEGITPQELCDKYNKLHKEVYDWFEIDFDHFGRTPTQQQTDIAQD
IFLKLYKNGYLEERTTTQPYCTKHNGFLADRFVEGECPLCGYNDARGDQCDKCGHLLDPL
ELIKPRCKLDGATPEPRETKHVFILLDKLQDQVAEWNRKSHEKGAWSDNGVNITNAWIKE
GLKPRGITRDLKWGTAVPLEGYDQKVLYVWFDACIGYVSITANYTEHWEQWWRNPENVEL
YQFMGKDNVPFHTVVFPCSQLGTGDKWTMLNTLSTTEYLNYERGKFSKSRGVGVFGTSAK
ETGIAPDVWRYFLLLRRPETSDTEFEWDGFIAANNNELVNNFGNFVNRILKYVNSPNYDS
TIPAAPELDPTSETAKSIQTHIKDVNDKLKQYREEMDAVHLKSGLVCAREISSLGNKLLQ
DNRLDNALFQSERARCDAVVNLAVNHVHLLASVIAPYLPATSRNILSQLQAELLIIPDEW
QADSIPAGHKIGKAAHLFKTIKPEKEAEWKEMFGGSELKKAKEEEAKKKAAKKAEKERKK
AKKAAERAEGKDGAGEKSVEAVEKDGAEKLTVEGDAVEEVTEGVRQAALQTS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtgcaaagaaggaagtcatcctgccggtggagggcaagaagaacgtgttgatc
acttccgcattgccatacgtcaacaatgtacctcatttgggaaacgtaattggcagcgtg
ctctcggcagacgtcttctcccgctacagcaaagcacgaggtcttcccacattgttcata
tgcggcacagacgaatatggcacagcgactgagacgaaagcgatcgaagagggcatcaca
ccgcaagagctctgcgacaaatacaacaagctccacaaggaagtctacgactggttcgag
attgactttgaccacttcgggcgcacgccgacccagcaacagacggatattgcgcaggat
atctttctgaagctatacaagaacggatacctcgaggagcgaacgacgacgcagccatac
tgcaccaagcataatggtttcctggcagaccgctttgtggaaggagagtgtccattgtgt
ggatacaacgacgcgagaggagatcaatgcgacaagtgtgggcacctgctagatccgctg
gagttgatcaagcctcgatgcaagctggatggtgcgacgccagagccgagagagacgaag
cacgtcttcatcttattggacaagttgcaggaccaagtggcagagtggaacagaaagagc
catgagaagggtgcgtggagtgacaatggtgtgaacattaccaatgcgtggatcaaggag
gggttgaagccgcgcggtatcactcgtgatctgaaatgggggactgcggtgccgttggaa
ggatacgaccagaaggtgttgtacgtctggttcgacgcttgcattggatacgtctcgatt
actgcaaactacacggaacactgggaacagtggtggaggaatccggagaatgtcgaattg
taccaattcatgggcaaagacaacgtgccattccatacggtcgtcttcccatgctcacaa
ctcggcaccggcgacaagtggactatgctcaacaccctcagcacgaccgaatacctcaac
tacgaacgcggaaagttcagcaagtctcgtggagtcggtgtttttggcaccagcgcgaaa
gagaccggcattgctcccgacgtctggcgatacttcctcctcctccgccgacccgagacc
agcgacacggagttcgaatgggatggcttcatcgcggccaacaacaacgagctcgtcaac
aatttcggcaactttgtcaaccgcatcctcaaatacgtcaactctcccaactacgactct
accatccccgccgcgccagaactcgaccctaccagtgagaccgccaaatccatccaaact
cacatcaaagacgtcaacgacaaactcaaacaataccgcgaagaaatggacgccgtgcac
ctcaaatccggcctcgtctgtgcgcgcgaaatctcctccctcggcaacaaactcctgcaa
gacaaccgtctcgacaatgccctcttccaatccgagcgcgcccgctgcgacgccgtcgtc
aacctcgccgtcaatcacgtccatctcctggcttccgtcatcgcgccttatctccccgct
acatcccggaacatcctctcccaactgcaagcggaactgctcatcatcccggacgagtgg
caagcggactccatcccagccggtcacaagatcggcaaagcggcgcacttgttcaagacg
attaaaccggagaaggaggcagagtggaaggagatgtttggcgggagtgaattgaaaaag
gcaaaggaggaggaggcgaagaagaaggcggcgaagaaggcggagaaggagaggaagaag
gcgaagaaggcggcggaacgggcggaggggaaggatggggctggagagaagagtgtggag
gcggtggagaaggatggggcggagaagttgactgtggagggggatgcggttgaggaggtt
accgagggggtgaggcaggctgcgttgcagacctcgtag

DBGET integrated database retrieval system