KEGG   Zymoseptoria tritici: MYCGRDRAFT_77366Help
Entry
MYCGRDRAFT_77366  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00220  Arginine biosynthesis
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01230  Biosynthesis of amino acids
Module
ztr_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MYCGRDRAFT_77366
Enzymes [BR:ztr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     MYCGRDRAFT_77366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace Glyco_hydro_4
Motif
Other DBs
NCBI-GeneID: 13401631
NCBI-ProteinID: XP_003848169
JGI: Mycgr3_77366
UniProt: F9XNL9
Position
12
AA seq 363 aa AA seqDB search
MASRTLRPASKTLRSLHLRQYTTTTSPAQPTTTSPFAPRHFLSISDLAPTELTTLVRNAS
SYKSSVKSGSIPPHLRQTLQNQTLALMFTKRSTRTRVSSESAITLLGGHPMFLGSQDIQL
GVNESLYDTSVVISSMVSAMIARVNAHEDVAGLAKHSSVPVINALSDLYHPLQTIADYQA
IIEAFPSSAEGRGKNSLGLEGLKIAWIGDANNVLFDLAIGAAKLGIHIAVATPKGYSIPP
FMRDIITSTAPNVQLTETNVPEEAVKDADILVTDTWVSMGQEEEAKKRMAAFEGFQITSE
LARRGGAREGWKFMHCLPRHPEEVSDEVFYDGKRSLVFPEAENRLWAAVSAIEGFVVNKG
KIA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccgaaccctccgccccgcctccaaaaccctccgctcccttcacctccgacaa
tacacaaccaccacctccccagcccaacccacaacaacctcgcccttcgccccccgacac
ttcctctccatctccgacctcgcccccaccgaactcaccaccctcgtccgcaatgcctcc
tcctacaaatcctccgtcaaatccggctccatcccacctcacctccgccaaaccctccaa
aaccagaccctcgccctcatgttcaccaaacgctccacccgcacccgcgtctcctccgaa
tccgccatcaccctcctcggcggccaccccatgttcctcggctcccaggacatccaactc
ggcgtcaacgagtccctctacgataccagtgtcgtgatcagcagcatggtgtccgctatg
atcgcacgagtcaacgcgcatgaggacgtagcgggactggcgaaacatagttccgtgccg
gtcatcaatgcgttgagtgatttgtatcatccccttcagacgattgcggactatcaggct
attatcgaggcgtttcctagctcggcggaggggagggggaagaatagtttggggctggaa
gggttgaagatagcctggatcggcgacgcgaataatgtgctcttcgacctcgccatcggc
gccgcgaagctggggatccacatcgccgtagccacaccaaaaggctactccatcccgccc
ttcatgcgggacatcatcacttccaccgcgcccaacgtgcaactcaccgaaaccaacgtc
cccgaagaagcggttaaagacgcggacattttagtgacggatacatgggtctcaatgggt
caggaagaagaggcgaagaagaggatggcagcgtttgaagggtttcaaatcacaagtgag
ttggcgaggaggggaggggcgagggaagggtggaaattcatgcattgtttgccgagacat
ccggaggaggtgagtgatgaggtgttctatgatgggaagaggagtttggtgttccccgaa
gcggagaatcggttgtgggcggcggtgagtgcgattgaggggtttgtggtgaataagggg
aagattgcgtga

DBGET integrated database retrieval system