KEGG   Zymoseptoria tritici: MYCGRDRAFT_77882Help
Entry
MYCGRDRAFT_77882  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
ztr  Zymoseptoria tritici
Pathway
ztr04136  Autophagy - other
ztr04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    MYCGRDRAFT_77882
   04136 Autophagy - other eukaryotes
    MYCGRDRAFT_77882
Membrane trafficking [BR:ztr04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    MYCGRDRAFT_77882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N BBS2_Mid
Motif
Other DBs
NCBI-GeneID: 13401346
NCBI-ProteinID: XP_003847609
JGI: Mycgr3_77882
UniProt: F9XQ68
Position
13
AA seq 1406 aa AA seqDB search
MRQRPTKEDVRRSGKKKKELNMRHGWEAQLSNEEVTRSLSENFFMYYEERRHETAGNLPP
GYDPASVLTEWRMKDRLKTVSALLAVCLNVGVDPPDVIKTNPCARLECWVDPVPPDSTNQ
SSNNTNAQIGKNLQSQYENLSLRTRYKVILDPTIEELKKYTTQLRRTAHAERLLFHYNGH
GVPKPTQSGEVWCFNRSYTQYIPISLYDLQEWVGAPGLWVWDCSAAGGIIQGFLEAAQKH
NLSQQEALQKDPNRAQQQAITKWEDCIHLAACRENEVLPTNPDLPADLFTSCLTTPIMMA
VRFFILQNPLTSTSGVSLAQARNIPGKVSERRTPLGELNWIFTAITDTIAWNMLPKPLFK
KLFRQDLMVAALFRNFLLAQRVMRMYHCHPLSYPAIPNTYDHPLWKSWDLAVEMILSQLP
RLIEQQKANDAALEYQHSDFFADQLSAFEVYLTSAPSNPGAAGYAKPPEQLPIVLQVLLS
QVHRLRALILLSKFLDLGPWAVSLALSIGIFPYVLKLLQSQALELKAPMVFIWSRILAVD
SSCQTDLLKDHGFAYFTNILVSTNGIPMGNVAEHRAMCTFIIAIFCKDMNAAKMAVLDSN
PEVIDCCLRHLHDMENPLLRQFSLLCLSHMVRDCSPVKDQFLAQNGGSRIADRSHDPVAE
VRVACLNALTSFIATGDSADAWVEHGEELLVRRQEEHLIGVVITMGMDGSIMVRRELTVL
YSEFVLKYMPRFLTAAWEQLLEEQDKKRGQEQNADDFVAMQAIEGSNDLQMINGTRAAIS
HNRSAAETSRGTVYRAVWRQLMSLSADPHPEISKNAGAIVDNVLNAVLESPLGTHAEAIL
DSLQSQEPIVDIILPATTPTASEALTKTKSNDTRPETPPSPAPSSASRPDGYFALSRTAS
VAAAMKNLIGWGPKTPGEPSSPGSPTHTRRNSAATPYRSRPLTPYDAALLPPDALDNITG
RPPHQPPANVPPTPFFKRREKNTLPDLPLKSEFFEWASSHFREVQMRPNEADEPGSKDYN
ERLWRRNRNDKIIASTQPLKEAAGSTPWDKPCGYFGIGAAPVKMVFHQFENHLVTSDDRD
SIAVWDWSAERQLHRFSNANPRGSRVTEVRFINEDDTAMLMIGSSDGVIKIYRNYESPEH
CHHVASFRALSDLVPSDKGGSGLVFDWQQGQGKALVAGDDRVVRVWGVGTELAIRDIGTR
SSACITSLTSDQVEGNIFVAGFGNGSVKAYDQRCEDKDTLVRGWNEHKSWIVGVHLQRGG
MRELISADSSGHIRLWDLRYPGAVAAINPPASRQEPRSLRTLSVHEHAPVFATGGKDHTI
RVYNTDLKPLSTFEPYMSYLRVGLSGAPRNAPITATAFHPHRMMLACGAVNDGHVNLFKC
DVEAEERGVLSSNVDAGQGVVQEWRG
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagcgaccgacgaaagaggatgtgcgaagatcgggcaagaagaagaaagagttg
aatatgcggcacggctgggaggcacaactttcgaacgaagaggtcacacgcagcctgagc
gagaacttcttcatgtactatgaggaaaggcgacatgagactgctgggaatctgccgccg
ggatatgatccggcgagtgtgctgaccgagtggcgcatgaaagatcgtctgaagaccgtc
tcggcactgctcgcggtctgtttgaatgttggagttgaccctccggatgtgatcaaaacc
aatccttgtgcccgtctggagtgctgggtcgatcctgttccgccggacagcacaaaccag
agctcgaacaatacaaacgcacaaatcgggaagaatctacagtcacaatacgagaacttg
tcactgcggacgcgatacaaggtcattctggatcccacgatagaggagctgaaaaagtac
accacacaacttcggcggacggcacatgcagagcggctactgtttcactacaatggtcat
ggtgtgccgaagccgacacaaagtggagaggtctggtgcttcaacagaagctacacacaa
tacattcccatcagtctatacgatctccaagagtgggtaggtgctccaggactttgggtg
tgggattgcagtgcagcaggtggtatcatccaaggtttcctagaagcggcgcagaaacac
aatctgagccagcaggaagctctgcaaaaagacccgaaccgcgctcaacagcaggccatt
acaaagtgggaagactgcatacatcttgcggcttgtcgagagaatgaagtgctccccacg
aatcccgaccttccggcagatcttttcacttcttgcctcacgactccaatcatgatggcg
gtacgattcttcatcctgcaaaatccactaacttccacatcgggcgtcagtcttgcccag
gcacggaacattcctggcaaagtcagtgagcgtagaacgccgttgggcgaactgaattgg
attttcacggcgatcacggatacgatcgcatggaacatgcttcccaagcctcttttcaag
aagctcttccggcaagacttgatggtggctgcattgttccgaaattttctcctggcacaa
agagtgatgcgaatgtaccactgtcatccgctgtcatatcctgccatccccaatacgtac
gatcatccactgtggaagagctgggatctggctgtggagatgattctttctcagcttccg
aggctgatcgaacagcagaaggcgaatgatgcggctcttgagtaccaacattcggacttc
ttcgccgatcaactgtccgcgtttgaagtgtacctcacttctgctccgagcaatcctggc
gcagcagggtatgccaaaccgccagagcaattgccgatcgtcctgcaagtgttactttcg
caagttcaccggctgagagcgctcattttgttgtccaaattcttggatcttggcccatgg
gcggtcagtcttgctctcagcattggaatcttcccctacgtgttgaagcttttgcagtct
caagctctcgaactcaaggctcccatggtgttcatttggtcgaggattcttgcggtggac
tcaagctgccagactgatctgctcaaggatcatggctttgcttactttacgaacattctc
gtctctaccaacggcattcccatgggtaatgttgctgaacatcgagcaatgtgcactttt
atcatcgcaatcttctgcaaggacatgaacgctgcgaaaatggctgttctcgacagtaat
ccagaagtcatcgattgttgcctgcggcacctccacgacatggagaatccactgttgcgg
cagttcagcttgctttgcttgagtcacatggtgcgagactgctcgcccgtaaaggatcaa
tttctcgcccagaatggtgggagtcgcatcgcagatcgtagtcacgaccctgtagcagag
gtccgggtggcctgcttgaacgccttgactagctttatcgccacgggtgattctgctgat
gcgtgggttgagcatggagaagaactccttgtacgacgacaagaggagcatctgattggc
gtcgtcatcactatgggaatggacggctccatcatggtgcgaagagaattgacggtgctg
tattcagagtttgtgctcaaatatatgcctcgctttcttaccgctgcgtgggagcagctt
ctcgaagaacaggacaagaagcgtgggcaagagcagaatgccgatgacttcgttgcgatg
caggcaattgaagggtcaaatgatcttcagatgatcaacggcacaagagcagccatatcg
cataatcgtagtgcagctgaaacatctcgcgggactgtataccgcgctgtgtggcgtcaa
ttgatgagcctttcagcagacccacatccagaaatctcgaagaacgccggtgccatcgtc
gataatgtgctcaatgcggtcctcgagtctccgctaggtacccacgccgaggcaatactc
gacagcttacaatcacaggagccgattgtcgacattattctccctgccaccacaccaact
gcatcggaagcactgacaaagacgaagtccaacgacacgcggccagaaacgcctcctagt
cctgcgccatcttcggcttcaagacccgatggctattttgccctttcgcgcactgccagt
gtcgctgctgcaatgaagaatctcatcggatggggtccgaaaacaccaggcgagccatca
tcccccggctcacctacgcacactcgtcgaaattccgcagccacaccctaccgatcacga
ccactcacgccatacgacgctgcactgctgccaccggacgctcttgataatattacaggg
cgtccgccgcatcagccgcccgcgaacgtccctccgacaccattcttcaagagacgcgag
aagaatactcttcctgatctgccgttgaaatccgaattcttcgaatgggcctcctcccac
ttccgcgaagtccagatgcgaccgaatgaagccgacgagccagggtcgaaagactacaat
gagcgactatggcgacggaaccgtaacgacaagatcattgcctcaacacaaccactgaag
gaagctgccggcagcacaccttgggataaaccttgcggctacttcggtatcggcgctgct
cctgtgaagatggtcttccaccaattcgaaaaccacctcgtcacctccgacgatcgggac
tccatcgccgtctgggactggtcagcagaacgtcaactccaccgcttctccaatgccaat
cctcgcggctcccgtgtgacggaagtccgcttcatcaacgaagatgacacagccatgctc
atgatcggatcttcggatggtgtcatcaagatctaccgcaattacgaatctcccgagcac
tgccaccatgtcgcttccttccgcgctctctccgatctggttccctccgacaaaggcgga
tccggtctcgtgttcgactggcaacaaggccaaggcaaggctcttgtggctggagatgac
cgcgtcgtccgcgtctggggcgtcggaaccgagctcgctatccgcgatatcggcacaagg
tcttctgcatgcatcacgtccctcacctccgaccaagtcgaaggcaacattttcgtcgcc
ggttttggtaatggtagcgtcaaagcttacgaccaacgctgcgaagacaaagacaccctc
gtccgcggctggaatgagcacaaatcgtggatcgttggcgtgcacctccagcgtggaggt
atgcgcgagctcatctccgctgactcgagcggccacattcgactctgggacttgcgctac
cctggggccgtggctgccatcaaccctcctgcttctcgacaagagccgcgcagtctacga
acactcagcgttcacgaacatgcgcctgtgtttgcaacgggaggtaaagatcatacgatt
agagtgtacaacacggatctcaaaccactcagtacgtttgagccgtatatgagttatttg
cgggttggattgagcggtgcgccgaggaatgcgccaatcacggcgacggctttccatccg
caccgtatgatgttggcttgtggggcggtgaatgatgggcatgtgaatttgttcaagtgt
gatgttgaggcggaggagaggggtgtgttgagtagtaatgttgatgctggacagggtgtt
gtgcaagagtggaggggttga

DBGET integrated database retrieval system