GenomeNet

>rs:NP_048200 [NP_048200] ORF MSV129 putative membrane protein (vaccinia L5R), similar to SW:P07615 [Melanoplus sanguinipes entomopoxvirus].
mvlvkekpnekiinlnptfilwdyekyfsygnftiyiitlieicfiifllfyffqqelif
iynyfvgpqktdddieqfnaldntlqeivnsslycngdnlyykykgesrqalalnnepit
dcnnilnkyvtfn

BLAST